Tap / click on image to see more RealViewsTM
CA$18.85
per set of 10 labels
 

yaie mystery 2 food label

Qty:
Food Container Label (5.1 cm x 7.6 cm)
-CA$7.55
-CA$7.55
-CA$9.45
-CA$11.35
-CA$7.55
-CA$7.55

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Food Container Label (5.1 cm x 7.6 cm)

Easily customise mason jars or food containers and make them 100% your own. Perfect for weddings, birthday parties, and baby showers.

  • Dimensions: 5 cm x 7.6 cm (2" x 3")
  • Each set includes 10 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 5.3 cm x 7.6 cm (2.1" x 3.01"). For best results please add 0.3 cm (0.12")bleed.

About This Design

yaie mystery 2 food label

yaie mystery 2 food label

yaie mystery 2. Black Friday deals on the street

Customer Reviews

4.9 out of 5 stars rating2K Total Reviews
1829 total 5-star reviews84 total 4-star reviews18 total 3-star reviews10 total 2-star reviews31 total 1-star reviews
1,972 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rita D.November 10, 2022Verified Purchase
Food Container Label (5.1 cm x 7.6 cm)
Zazzle Reviewer Program
I bought these labels for my candle jars and they were perfect! Good quality. Able to peel them off without residue on the jar. Nice matte finish. Perfect! Exactly what was ordered
5 out of 5 stars rating
By Chelsea F.December 22, 2022Verified Purchase
Food Container Label (7.6 cm x 5.1 cm)
Zazzle Reviewer Program
Looked great, nice quality. Really nice, nice feel
5 out of 5 stars rating
By Chelsea F.December 22, 2022Verified Purchase
Food Container Label (7.6 cm x 5.1 cm)
Zazzle Reviewer Program
Loved the feel and the quality, worked great for my candles. As expected, looks great

Tags

Food and Beverage Label Sets
yaeiyaiewiccasatanwitchcraftmangaanimedarkblack
All Products
yaeiyaiewiccasatanwitchcraftmangaanimedarkblack

Other Info

Product ID: 256797795453148292
Designed on 2024-02-11, 6:01 PM
Rating: G