Tap / click on image to see more RealViewsTM
Sale Price CA$51.68.  
Original Price CA$60.80 per shirt
You save 15%

Wine Winemaker Grapevine Grape T-Shirt

Qty:
Basic Dark T-Shirt
-CA$2.85
+CA$20.20
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favourites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customize it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Wine Winemaker Grapevine Grape T-Shirt

Wine Winemaker Grapevine Grape T-Shirt

A super grapevine drawing for winemakers and wine lovers who like grapevines. A great design idea also for hobby gardeners who like to grow wine. The grapevine is a great motif for winemakers and wine connoisseurs who love their grapes.

Customer Reviews

4.7 out of 5 stars rating32.8K Total Reviews
25663 total 5-star reviews4979 total 4-star reviews1120 total 3-star reviews505 total 2-star reviews484 total 1-star reviews
32,751 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Bob L.July 1, 2022Verified Purchase
Basic Dark T-Shirt, Black, Large
Zazzle Reviewer Program
They turned out exactly as we had hoped and we looked good even when we didn't bowl well. The printing was perfect and you can only see 9 pins on the shirt(the 5 pin hidden behind the headpin) which worked for us as we bowled in a 9 pin No-Tap league.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Toni D.November 6, 2022Verified Purchase
Basic Dark T-Shirt, Black, Small
Zazzle Reviewer Program
Great t-shirt!!! Quality is amazing and the colours are vibrant. Exactly how described!!! Can’t wait for my daughter to ask and give it to her confirmation sponsor. It’s also came earlier than I expected. Colours were exactly what I expected. The quality is amazing. The images couldn’t be any better. I’m very happy with his product and highly recommend it.
5.0 out of 5 stars rating
5 out of 5 stars rating
By ARLENE B.January 14, 2022Verified Purchase
Basic Dark T-Shirt, Black, Small
Zazzle Reviewer Program
The quality of the shirts is top notch, comfortable, well fitting, the material is great. The shirts are well made and we were proud to wear them. The colors were as bright, clear and pure as advertised, easily read, not only by us, but by family and friends who saw us while we were wearing them, immediately smiled, congratulated us, asked more about our big day 50 years ago.. The printing showed up great in pictures, and we have attached a copy of us wearing them.

Tags

T-Shirts
winegrapevinewinemakerslikegreatmotifconnoisseurstheirgrapesfarmer
All Products
winegrapevinewinemakerslikegreatmotifconnoisseurstheirgrapesfarmer

Other Info

Product ID: 235321457657820985
Designed on 2022-01-04, 11:59 AM
Rating: G