Tap / click on image to see more RealViewsTM
CA$3.75
per sticker
 

Whimsigoth aesthetic witchcraft symbols

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm L x 8.89 cm H
  • Design Area: 7.62 cm L x 7.62 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317. cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Whimsigoth aesthetic witchcraft symbols

Whimsigoth aesthetic witchcraft symbols

Whimsigoth aesthetic witchcraft symbols sticker pack. Witchy academia quotes stickers. Illustrations and words inspired by witchcraft. Snake and crescent moon stickers for scrapbooking.

Customer Reviews

4.9 out of 5 stars rating39 Total Reviews
37 total 5-star reviews2 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
39 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ralf K.February 27, 2023Verified Purchase
Zazzle Reviewer Program
They worked perfect for our signs! Perfect! excellent quality.
5 out of 5 stars rating
By Terra P.November 9, 2020Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
They turned out just how I wanted! The font was clear and gave the classic look I was hoping for! Colors were striking and looked just like the picture! I was more than pleased!
5 out of 5 stars rating
By M.June 14, 2021Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The colors were completely accurate, and the stickers are very good quality. The image quality was excellent.

Tags

Custom-Cut Vinyl Stickers
whimsigothsnakewitchwitchywitchcraftmagicmooncelestialblack and redaesthetic
All Products
whimsigothsnakewitchwitchywitchcraftmagicmooncelestialblack and redaesthetic

Other Info

Product ID: 256379090712264935
Designed on 2023-10-04, 5:23 AM
Rating: G