Tap / click on image to see more RealViewsTM
CA$5.35
per sticker
 

Whimsigoth aesthetic witchcraft symbols

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 7.62 cm x 7.62 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Whimsigoth aesthetic witchcraft symbols

Whimsigoth aesthetic witchcraft symbols

Whimsigoth aesthetic witchcraft symbols sticker pack. Witchy academia quotes stickers. Illustrations and words inspired by witchcraft. Snake and crescent moon stickers for scrapbooking.

Customer Reviews

4.9 out of 5 stars rating40 Total Reviews
37 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews0 total 1-star reviews
40 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ralf K.February 27, 2023Verified Purchase
Zazzle Reviewer Program
They worked perfect for our signs! Perfect! excellent quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Terra P.November 9, 2020Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
They turned out just how I wanted! The font was clear and gave the classic look I was hoping for! Colors were striking and looked just like the picture! I was more than pleased!
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.June 14, 2021Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The colors were completely accurate, and the stickers are very good quality. The image quality was excellent.

Tags

Custom-Cut Vinyl Stickers
whimsigothsnakewitchwitchywitchcraftmagicmooncelestialblack and redaesthetic
All Products
whimsigothsnakewitchwitchywitchcraftmagicmooncelestialblack and redaesthetic

Other Info

Product ID: 256379090712264935
Designed on 2023-10-04, 5:23 AM
Rating: G