Tap / click on image to see more RealViewsTM
CA$30.15
per sticker
 

Wedding individual guest names script labels

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Large 35.56 cm x 35.56 cm Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 35.6 cm L x 14.12.7 cm W
  • Design Area: 35.6 cm L x 35.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Wedding individual guest names script labels

Wedding individual guest names script labels

Simple elegant custom wedding 24 guest name labels with a chic black and white classic handwriting calligraphy script.

Customer Reviews

4.2 out of 5 stars rating203 Total Reviews
146 total 5-star reviews15 total 4-star reviews10 total 3-star reviews9 total 2-star reviews23 total 1-star reviews
203 Reviews
Reviews for similar products
5 out of 5 stars rating
By D.April 4, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
User friendly made ordering easy. Quick turnaround time. Super pleased with the clear labels and script. I have the best dressed invitation envelopes and have received numerous compliments. Would definitely recommend and buy again. Excellent quality would highly recommend.
4 out of 5 stars rating
By Marlies F.March 4, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Beautiful font and printing - only "downsize" was it was very difficult to estimate the size of the labels from the website. The extra-large labels are very big. Design and quality of printing is very good.
4 out of 5 stars rating
By Marlies F.March 4, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Very good quality and durability - personally, I found it very difficult to judge the size of the labels from the website and ended up order extra-large, they are incredibly big. Good printing and image quality.

Tags

Custom-Cut Vinyl Stickers
guest names wedding stickersblack and whitestylishsimplescriptindividual names for place cardhandwriting calligraphy24 wedding guest names labelselegantclassic
All Products
guest names wedding stickersblack and whitestylishsimplescriptindividual names for place cardhandwriting calligraphy24 wedding guest names labelselegantclassic

Other Info

Product ID: 256818840828089474
Designed on 2026-05-13, 10:55 PM
Rating: G