Tap / click on image to see more RealViewsTM
CA$12.10
per sticker
 

watercolour world map RV - STICKER

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Medium 15.24 cm x15.24 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm L x 16.51 cm H
  • Design Area: 15.24 cm L x 15.24 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

watercolour world map RV - STICKER

watercolour world map RV - STICKER

STICKER VANLIFE, motorhome, van, travel, travelling, adventure, explore, map, world, country, campervan, watercolour, holiday, travels, exploring, traveller, travellife, life, living, cartoon, digitalart, rv, caravan, kombi, homeonwheel, explorer, watercolour, colour, nomad, earth, vacation, vaner, wonderlust, wonderluster, worldmap, travelblog, getaway, exploringtheglobe, roadtrip, tourist, worldnomad, sticker, bumpersticker

Customer Reviews

4.5 out of 5 stars rating2 Total Reviews
1 total 5-star reviews1 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
2 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lawana H.January 24, 2026Verified Purchase
This turned out great!!
from zazzle.com (US)
4 out of 5 stars rating
By Amy H.May 28, 2020Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Creator Review
Put Sticker on a Planner! It looks nice. No fade. good qaulity printing.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
motorhomestickertravelvanlifecampervancaravanroadtripworld mapmapholiday
All Products
motorhomestickertravelvanlifecampervancaravanroadtripworld mapmapholiday

Other Info

Product ID: 256688614948988576
Designed on 2019-05-01, 6:45 AM
Rating: G