Tap / click on image to see more RealViewsTM
CA$49.20
per poster
 

Vintage Travel Poster London

Qty:
Choose Your Format
20"x24"
None

Other designs from this category

About Posters

Sold by

Paper Type: Value Poster Paper (Semi-Gloss)

Your walls are a reflection of your personality, so let them speak with your favorite quotes, art, or designs printed on our custom Giclee posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom size posters and framing options to create art that’s a perfect representation of you.

  • Gallery quality Giclee prints
  • Ideal for vibrant artwork and photo reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-color spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 152.4 cm
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Vintage Travel Poster London

Vintage Travel Poster London

Vintage Travel Poster London Vintage style travel poster for London, England , public domain , skyline, cityscape

Customer Reviews

4.8 out of 5 stars rating14.4K Total Reviews
12378 total 5-star reviews1349 total 4-star reviews260 total 3-star reviews154 total 2-star reviews277 total 1-star reviews
14,418 Reviews
Reviews for similar products
5 out of 5 stars rating
By C S.July 26, 2023Verified Purchase
Print, Size: 20.32cm x 25.40cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
My Bible verse postcard, turned out excellent. I love it and have it already framed. It was so reasonably priced for something done so well. Thank you to Zazzle and the artist! I thought it looked exactly like what I ordered. Perfect.
4 out of 5 stars rating
By Lee P.December 25, 2021Verified Purchase
Print, Size: 58.42cm x 87.63cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
Poster is printed clearly, good quality . Inclusive of many prints . The shipping was the problem. Box was flimsy and item got bent.. only suggestion would have been to put in a canister or mark fragile. Printing was exactly as shown
5 out of 5 stars rating
By R.January 28, 2021Verified Purchase
Print, Size: 91.44cm x 60.96cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
I am a fan of Ravens and needed to have a poster of my favourite bird. The image quality is sharp.

Tags

Posters
englandpublic domainskylinecityscapevintagetravelposterlondonstylefor
All Products
englandpublic domainskylinecityscapevintagetravelposterlondonstylefor

Other Info

Product ID: 256404728822493100
Designed on 2024-07-19, 7:09 AM
Rating: G