Tap / click on image to see more RealViewsTM
Sale Price CA$2.64.  
Original Price CA$3.10 per postcard
You save 15%

Vintage Italy Italian Map Travel Postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-CA$0.30

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H; qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Vintage Italy Italian Map Travel Postcard

Vintage Italy Italian Map Travel Postcard

Anyone would love to receive this vintage Italia travel postcard featuring a map of Italy with flowers and bees! Your recipient will appreciate the floral and Italian architecture motif of this postcard!

Customer Reviews

4.9 out of 5 stars rating16K Total Reviews
14599 total 5-star reviews1036 total 4-star reviews203 total 3-star reviews74 total 2-star reviews118 total 1-star reviews
16,030 Reviews
Reviews for similar products
5 out of 5 stars rating
By Denise W.May 1, 2024Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
I'm in love! Just look how sweet these two are! 🥰☘🍀. Great graphics n print! Glossy adds flair! Thanks! ☘🍀
5 out of 5 stars rating
By Tina J.March 5, 2019Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
nicely done very clear. print turned out well done
5 out of 5 stars rating
By Denise W.May 1, 2024Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
🐰🐇..Bundorable sweet card! Love the vintage vibe which I wanted! Not a flimsy card! Graphics are awesome n print so good!

Tags

Postcards
italyvintagemaptravelitalianitaliafloralflowersbeesarchitecture
All Products
italyvintagemaptravelitalianitaliafloralflowersbeesarchitecture

Other Info

Product ID: 256641283317229366
Designed on 2021-10-09, 5:01 AM
Rating: G