Tap / click on image to see more RealViewsTM
CA$16.05
CA$5.35 per sheet of tissue paper
 

Vintage French Poster Cats Girl Milk Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 35.56 cm x 50.8 cm

Customise your own creative tissue paper for gift wrapping. You can add something simple like the recipients’ name, or get fancy by adding a cool design, photo, image, or artwork for a one-of-a-kind look. Add pizazz to any present!

  • Please note that this size tissue arrives folded
  • Dimensions: 35.56 cm L x 50.8 cm W unfolded (35.56 cm L x 25.4 cm W folded)
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

Vintage French Poster Cats Girl Milk Tissue Paper

Vintage French Poster Cats Girl Milk Tissue Paper

Darling French vintage Lait Pur de la Vingeanne Sterilise Art Print by Théophile Alexandre Steinlen, with Cats at the foot of a Girl drinking Milk, is on this Tissue Paper. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating2.9K Total Reviews
2680 total 5-star reviews153 total 4-star reviews45 total 3-star reviews23 total 2-star reviews42 total 1-star reviews
2,943 Reviews
Reviews for similar products
5 out of 5 stars rating
By Darlene B.December 14, 2021Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 25.4 cm x 35.56 cm
Zazzle Reviewer Program
This decoupage paper looks amazing on the old cedar trunk I refinished. It has made the trunk a special gift for my grandson. The design itself turned out much better than I expected. I am very pleased.
5 out of 5 stars rating
By Lucy B.December 20, 2021Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm
Zazzle Reviewer Program
Great quality decoupage paper! I bought this paper to use on a piece of furniture. It was super easy to use and the quality of the image was really good very happy with the product and will continue to purchase more. I bought this paper to use on a piece of furniture. It was super easy to use and the quality of the image was really good very happy with the product and will continue to purchase more.
5 out of 5 stars rating
By Tessa M.December 23, 2021Verified Purchase
Zazzle Reviewer Program
Gorgeous paper, a little heavier than traditional decoupage tissue, but it worked beautifully on my project nonetheless. Elegant - simple- tres chic! The printing turned out beautifully, it is consistent throughout the entire print with a somewhat faded or mottled coloration. I am in love with this paper.
Original product

Tags

Tissue Paper
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets
All Products
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets

Other Info

Product ID: 256007565250066876
Designed on 2019-09-07, 6:08 AM
Rating: G