Tap / click on image to see more RealViewsTM
CA$50.70
per roll
 

Viking Pattern Blue Wrapping Paper

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Glossy Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and different five sizes, our wrapping paper has all of your gift wrapping needs covered - because the presentation matters just as much as the present!

  • 64lb, print quality glossy paper
  • Ideal for printing photos
  • Full color edge to edge printing
  • Width: 29 inches
  • Length: Multiple choices from 6 feet - 60 feet
  • Each roll up to 15 feet in length; Lengths greater than 15 feet shipped as multiple 15 foot rolls
  • Length guide:
    • 6 foot roll wraps 3 shirt-sized boxes
    • 15 foot roll wraps 9 shirt-sized boxes
    • 30 foot roll wraps 18 shirt-sized boxes
    • 45 foot roll wraps 27 shirt-sized boxes
    • 60 foot roll wraps 36 shirt-sized boxes
  • Printed in USA
  • Designable area is 36" x 30", but is scaled down uniformly and printed at 34.8" x 29"
  • Please note: Designs are tiled after first 34.8" x 29" printed section.

About This Design

Viking Pattern Blue Wrapping Paper

Viking Pattern Blue Wrapping Paper

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating4K Total Reviews
3377 total 5-star reviews379 total 4-star reviews116 total 3-star reviews69 total 2-star reviews87 total 1-star reviews
4,028 Reviews
Reviews for similar products
5 out of 5 stars rating
By V.October 18, 2023Verified Purchase
Zazzle Reviewer Program
This is a great roll of wrapping paper. It's good for many occasions and can be used for him or hers gifts. I was looking for a gender neutral paper that I could use in my shop that also incorporated the color pink like our logo without it being too feminine. I believe we achieved that with this wrapping paper. The paper quality it excellent and we look forward to continuing with this design for years to come. Perfect, no printing streaks or lines like i have seen in some of the other papers I've ordered.
5 out of 5 stars rating
By V.October 18, 2023Verified Purchase
Zazzle Reviewer Program
There isn't much to say about this paper other than it's perfect and gorgeous. I purchased the matte option and I'm glad I did, this paper has that boutique look and feel to it. Paper quality it top notch as well - thick and expensive looking. Thanks! Perfect, no lines or streaks, colors are vibrant and exactly as shown in the photos.
5 out of 5 stars rating
By S.November 30, 2022Verified Purchase
Zazzle Reviewer Program
I used this wrapping paper as packaging for my soaps. The design was as expected, and the quality of the paper is excellent. I love this wrapping paper. `I will order again. I am satisfied with the print quality and design, Everything was as expected.

Tags

Wrapping Paper
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256797846469617735
Designed on 2016-12-19, 7:28 PM
Rating: G