Tap / click on image to see more RealViewsTM
CA$12.55
per set of 6 labels
 

Viking Pattern Blue Wine Label

Qty:
Wine Bottle Label (3.5" x 4")
-CA$2.10
-CA$4.20
+CA$8.40
+CA$8.40
+CA$8.40
+CA$8.40
+CA$8.40

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label (3.5" x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Viking Pattern Blue Wine Label

Viking Pattern Blue Wine Label

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating1.9K Total Reviews
1793 total 5-star reviews83 total 4-star reviews14 total 3-star reviews10 total 2-star reviews27 total 1-star reviews
1,927 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.April 14, 2020Verified Purchase
Wine Bottle Label (3.5" x 4")
Zazzle Reviewer Program
These wine bottle labels came out just perfect and even better in person. You won’t be disappointed and working with the labels were so easy. They stick easily and firmly on the bottles with no issues of application. The best part is how stunning it looks on the wine bottles! Printing was beautiful with no bleeding and colours were clear and exactly how it was pictured!
4 out of 5 stars rating
By Victoria M.December 5, 2020Verified Purchase
Wine Bottle Label (3.5" x 4")
Zazzle Reviewer Program
Perfect idea for a Valentine's Day present for your significant other. It comes with enough labels to paste on as many bottles as you'd think you would gift someone. It is easy to place on the bottle and a perfect size. Can't wait to gift this soon! Colours are vibrant and exactly as shown online. The printing is clear and meets the expectations.
5 out of 5 stars rating
By JPeter K.January 13, 2023Verified Purchase
Wine Bottle Label (3.5" x 4")
Zazzle Reviewer Program
Make our own wine labels for soo many events even just little get togethers cheap easy n fast soo cool I rate this a 10 out of 10 And superb quality. Always just as the preview perfect

Tags

Food and Beverage Label Sets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256235785226518717
Designed on 2017-11-18, 11:50 AM
Rating: G