Tap / click on image to see more RealViewsTM
CA$33.75
per mug
 

Viking Pattern Blue Two-Tone Coffee Mug

Qty:
Two-Tone Mug
-CA$1.60
+CA$1.55
Black

Other designs from this category

About Mugs

Sold by

Style: Two-Tone Mug

Add a pop of color to your morning coffee! The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the inside is vividly glazed in rich color. Give this fun gift to a friend, or add some zest to your dinnerware collection.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8" H
    • 15-ounce: 3.4” D x 4.5" H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Viking Pattern Blue Two-Tone Coffee Mug

Viking Pattern Blue Two-Tone Coffee Mug

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating22.6K Total Reviews
19906 total 5-star reviews1910 total 4-star reviews341 total 3-star reviews157 total 2-star reviews246 total 1-star reviews
22,560 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lori B.March 8, 2024Verified Purchase
Classic Mug, 325 ml
I bought this for my niece's birthday and she loved it! She uses it daily! Thanks Zazzle for always making it right! Quality was excellent!
5 out of 5 stars rating
By AnonymousSeptember 29, 2017Verified Purchase
Two-Tone Mug, 325 ml
Zazzle Reviewer Program
I ordered these with interiors of yellow, red, maroon, pink, navy blue, and light blue. Note that the navy blue is VERY dark and looks black in some lighting. The mugs have survived 10 months of use so far! My friends were all very happy with them. Print turned out very clear. Colours were accurate. Thank you!
5 out of 5 stars rating
By V.December 22, 2021Verified Purchase
Two-Tone Mug, 444 ml
Zazzle Reviewer Program
This was my second order. Every staff member in the office has their individual mug with their name. This gives us peace of mind in terms of hygiene (especially during covid-19) and as a side effect, we know who did not clean up after themselves after lunch. It was fun to design according to one's personality and was received with a joy.. Also it makes a thoughtful gift for any occasion. Print was easy to design and turned out to be a very good quality. No flaws.

Tags

Mugs
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 168824120322378292
Designed on 2016-12-19, 7:15 PM
Rating: G