Tap / click on image to see more RealViewsTM
CA$34.70
per hitch cover
 

Viking Pattern Blue Trailer Hitch Cover

Qty:
Hitch Cover 5.1 cm Receiver

About Hitch Cover

Sold by

Size: Hitch Cover 5.1 cm Receiver

Let your SUV, RV, truck, or car do the talking with a customised hitch cover! Made in the U.S.A with heavy duty plastic, this cover secures to your receiver with a hitch clip (not included). Your designs, images, and text are printed in full colour on a metal plate to make a bold statement wherever you go.

  • Dimensions: 13 cm x 9.8 cm W. Available in two sizes to fit the 3.2 cm (small) or 5.1 cm (large) receiver.
  • 5.1 cm receiver is traditionally for SUV and Pickups; 3.2 cm receiver typically fits Minivans and smaller cars.
  • Made with heavy duty plastic
  • Secures with hitch clip (not included)
  • Printed in full colour on metal plate
  • Proudly made in USA
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 11.9 cm x 8.9 cm. For best results please add 0.36 cm bleed..

About This Design

Viking Pattern Blue Trailer Hitch Cover

Viking Pattern Blue Trailer Hitch Cover

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating156 Total Reviews
127 total 5-star reviews15 total 4-star reviews4 total 3-star reviews4 total 2-star reviews6 total 1-star reviews
156 Reviews
Reviews for similar products
5 out of 5 stars rating
By L.July 26, 2021Verified Purchase
Hitch Cover 5.1 cm Receiver
Zazzle Reviewer Program
We have put a trailer hitch on our SUV and wanted to have an attractive way to cover it when not pulling the trailer. This is exactly what we wanted! The colours and design are great. It’s new so we don’t know how it will last with exposure to the elements. It looks great now.
5 out of 5 stars rating
By G.September 11, 2023Verified Purchase
Hitch Cover 5.1 cm Receiver
Zazzle Reviewer Program
Exactly what I was looking for. Great fit. Colour spot on. Looks great.
5 out of 5 stars rating
By Y.June 18, 2015Verified Purchase
Hitch Cover 5.1 cm Receiver
Zazzle Reviewer Program
It's exactly what I thought it would be. Can't wait to put it on my truck. The writing could have been a bit bigger to fill the space better but I still like it.

Tags

Hitch Cover
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256460242050496216
Designed on 2017-11-19, 9:55 AM
Rating: G