Tap / click on image to see more RealViewsTM
CA$50.00
each
 

Viking Pattern Blue Tote Bag

Qty:
  1. Style

  2. Size

Other designs from this category

About Totes

Sold by

Style: All-Over-Print Tote Bag, Medium

The classic tote with a modern twist: all-over-print allows for 100% customization, bringing the basic tote to the next level. Your next shopping trip just got a little more earth-friendly and a lot more stylish!

  • Dimensions: 40.6 cm l x 40.6 cm w; Strap: 71.1 cm l
  • Material:
    • Exterior: 100% sturdy brushed polyester
    • Interior: 100% polyester nonwoven laminate
  • 100% cotton web handles
  • Printed then sewn for edge-to-edge designs
  • Black laminated lining for extra support
  • Spot or dry clean only
  • Made in the USA

About This Design

Viking Pattern Blue Tote Bag

Viking Pattern Blue Tote Bag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating2.3K Total Reviews
2143 total 5-star reviews121 total 4-star reviews18 total 3-star reviews7 total 2-star reviews20 total 1-star reviews
2,309 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By OZIEL L.January 4, 2019Verified Purchase
All-Over-Print Tote, Cross-Body Bag, Medium
Creator Review
Totally thrilled with this bag. The material is thick and durable (this is my third purchase of this tote bag). The printing turned out amazing. The bright red was just as bright as it is on the computer. So impressed with this bag.
5.0 out of 5 stars rating
5 out of 5 stars rating
By OZIEL L.August 3, 2018Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Creator Review
Beautiful quality tote bag in a heavy coated canvas. Shoulder strap is perfect length. Graphics are absolutely beautiful. The printing was great. The pink and black were perfect but the green didn't print as rich in color.
5.0 out of 5 stars rating
5 out of 5 stars rating
By OZIEL L.August 3, 2018Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Creator Review
INCREDIBLE! These bags are beautifully made with a thick canvas fabric, and a shoulder strap that hangs perfectly. This is the smaller of the two sizes that I ordered. So Impressed. The printing is immaculate. The colors are just as deep and rich as the online image display. These are excellent quality printing.

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256198166661462734
Designed on 2017-07-28, 10:07 PM
Rating: G