Tap / click on image to see more RealViewsTM
CA$138.00
per throw blanket
 

Viking Pattern Blue Throw Blanket

Qty:

    Other designs from this category

    About Throw Blankets

    Sold by

    Size: Throw Blanket

    This all-season throw blanket is designed for curling up with a cup of hot cocoa or relaxing on a summer evening with a cool glass of lemonade. Put a unique and stylish touch on your décor with your favourite patterns or designs or make one with your family photo memories for grandparents, moms, and dads!

    • Dimensions: 137.16 cm l x 96.52 cm w
    • Material: 100% polyester; soft touch
    • Hand wash cold. Do not bleach. Line dry. Do not wring.
    • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 140 cm x 88.26 cm

    About This Design

    Viking Pattern Blue Throw Blanket

    Viking Pattern Blue Throw Blanket

    Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

    Customer Reviews

    4.6 out of 5 stars rating192 Total Reviews
    143 total 5-star reviews35 total 4-star reviews7 total 3-star reviews3 total 2-star reviews4 total 1-star reviews
    192 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By JassicaDecember 20, 2017Verified Purchase
    Throw Blanket
    Zazzle Reviewer Program
    Amazing and came exactly as listed 6-9 days. Perfect in time for Christmas. I am so obsessed with this. Although it said the pictures may not come out clear as they were mainly taken from a phone camera, they came out really nice on the throw blanket. It is pixelated but still extremely visible.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Tessa D.July 6, 2020Verified Purchase
    Throw Blanket
    Zazzle Reviewer Program
    The overall experience with Zazzle was a pressure. Adding images to the design was easy and didn't take much time. The quality of the photos on the blanket was perfect!
    3.0 out of 5 stars rating
    3 out of 5 stars rating
    By AnonymousApril 7, 2025Verified Purchase
    Throw Blanket
    While I do love it very much and its listed properly so I like that. The only thing I didn't like was the quality of the print but its a reminder that its imperfect. However in regards to quality I have to leave 3 stars due to lack of detail. .

    Tags

    Throw Blankets
    scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
    All Products
    scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

    Other Info

    Product ID: 256771172664853319
    Designed on 2017-11-18, 12:55 PM
    Rating: G