Tap / click on image to see more RealViewsTM
CA$147.00
per throw blanket
 

Viking Pattern Blue Throw Blanket

Qty:

Other designs from this category

About Throw Blankets

Sold by

Size: Throw Blanket

This all-season throw blanket is designed for curling up with a cup of hot cocoa or relaxing on a summer evening with a cool glass of lemonade. Put a unique and stylish touch on your décor with your favourite patterns or designs or make one with your family photo memories for grandparents, moms, and dads!

  • Dimensions: 137.16 cm l x 96.52 cm w
  • Material: 100% polyester; soft touch
  • Hand wash cold. Do not bleach. Line dry. Do not wring.
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 140 cm x 88.26 cm

About This Design

Viking Pattern Blue Throw Blanket

Viking Pattern Blue Throw Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating189 Total Reviews
141 total 5-star reviews35 total 4-star reviews7 total 3-star reviews3 total 2-star reviews3 total 1-star reviews
189 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.December 20, 2017Verified Purchase
Throw Blanket
Zazzle Reviewer Program
Amazing and came exactly as listed 6-9 days. Perfect in time for Christmas. I am so obsessed with this. Although it said the pictures may not come out clear as they were mainly taken from a phone camera, they came out really nice on the throw blanket. It is pixelated but still extremely visible.
5 out of 5 stars rating
By Tessa D.July 6, 2020Verified Purchase
Throw Blanket
Zazzle Reviewer Program
The overall experience with Zazzle was a pressure. Adding images to the design was easy and didn't take much time. The quality of the photos on the blanket was perfect!
3 out of 5 stars rating
By AnonymousApril 7, 2025Verified Purchase
Throw Blanket
While I do love it very much and its listed properly so I like that. The only thing I didn't like was the quality of the print but its a reminder that its imperfect. However in regards to quality I have to leave 3 stars due to lack of detail. .

Tags

Throw Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256771172664853319
Designed on 2017-11-18, 12:55 PM
Rating: G