Tap / click on image to see more RealViewsTM
CA$17.50
CA$1.75 per sheet
 

Viking Pattern Blue Stationery

Qty:
Thin Matte Paper

4.1pt thickness / 80 lb weight
Crisp white, matte finish

+CA$0.22
+CA$0.22
+CA$0.22

Other designs from this category

About Stationery

Sold by

Size: 5.5" x 8.5"

The paper you write on can say just as much as the words written on it, so make your notes stand out with stationery for your home and office. Choose from 5 different paper types and write letters and business correspondence that will make everyone take notice!

  • 21.6 cm l x 14 cm w (portrait) or 14 cm l x 21.6 cm w (landscape)
  • Choice of five paper types
  • High quality, full-colour, full-bleed printing
  • Creator Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 14 cm x 21.6 cm. For best results please add 1.5 mm bleed

Paper Type: Thin Matte Paper

Your business and personal mailings will have a crisp professional look on this matte. Contains 50% recycled content (10% post-consumer and 40% pre-consumer waste).

About This Design

Viking Pattern Blue Stationery

Viking Pattern Blue Stationery

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating395 Total Reviews
325 total 5-star reviews42 total 4-star reviews19 total 3-star reviews4 total 2-star reviews5 total 1-star reviews
395 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sandra E.November 13, 2025Verified Purchase
Stationery Paper, Size: 5.5" x 8.5", Paper: Recycled, Envelopes: None
EVERYTHING I'VE ORDERED IS ALWAYS A EXCELLENT QUALITY.
5 out of 5 stars rating
By Sandra E.May 19, 2025Verified Purchase
Stationery Paper, Size: 5.5" x 8.5", Paper: Recycled, Envelopes: None
This was exactly what I was looking for .
5 out of 5 stars rating
By L F.September 9, 2013Verified Purchase
Stationery Paper, Size: 5.5" x 8.5", Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
This paper is the most beautiful design and would be great for anything related to Winter or Christmas! fantastic. High grade lined stationary!

Tags

Stationery
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 229486491158181475
Designed on 2017-11-18, 12:08 PM
Rating: G