Tap / click on image to see more RealViewsTM
CA$44.90
per stocking
 

Viking Pattern Blue Small Christmas Stocking

Qty:
  1. Size

  2. Fabric

  3. Back Side

Other designs from this category

About Christmas Stockings

Sold by

Size: Christmas Stocking (22.9 cm x 40.6 cm)

Stop Santa in his tracks this year with fabulous one-of-a-kind stockings. Made from bright and vividly printed polyester, these stockings are too pretty for coal. Give holiday cheer when you gift a 100% personalized stocking decorated with favourite pictures, treasured memories, cherished quotes, and more. The perfect addition to brighten any holiday mantle decor.

  • Dimension: 22.9 cm x 40.6 cm
  • Material: Available in 3 different styles; all 100% polyester
  • Sturdy sewn-in loop for hanging
  • Machine washable, lay flat to dry
  • Made in USA

About This Design

Viking Pattern Blue Small Christmas Stocking

Viking Pattern Blue Small Christmas Stocking

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating446 Total Reviews
358 total 5-star reviews65 total 4-star reviews10 total 3-star reviews6 total 2-star reviews7 total 1-star reviews
446 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By DebbieDecember 1, 2021 • Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Very impressed with the style and size. The pattern is very beautiful
5.0 out of 5 stars rating
5 out of 5 stars rating
By AmyJanuary 17, 2026 • Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
The stocking is excellent! great quality and large enough to fit all her favorite toys! .
4.0 out of 5 stars rating
4 out of 5 stars rating
By Leanne S.December 16, 2020 • Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Very pleased with my order. Arrived well before Christmas and they are larger than expected, which is great. So happy I will have these for years to come. Colours nice, everything spelled correct.

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256886378358240183
Designed on 2017-11-18, 12:42 PM
Rating: G