Tap / click on image to see more RealViewsTM
CA$32.60
per stocking
 

Viking Pattern Blue Small Christmas Stocking

Qty:
Small
Brushed Poly
Red Back Panel

Other designs from this category

About Christmas Stockings

Sold by

Size: Christmas Stocking (22.9 cm x 40.6 cm)

Stop Santa in his tracks this year with fabulous one-of-a-kind stockings. Made from bright and vividly printed polyester, these stockings are too pretty for coal. Give holiday cheer when you gift a 100% personalized stocking decorated with favourite pictures, treasured memories, cherished quotes, and more. The perfect addition to brighten any holiday mantle decor.

  • Dimension: 22.9 cm x 40.6 cm
  • Material: Available in 3 different styles; all 100% polyester
  • Sturdy sewn-in loop for hanging
  • Machine washable, lay flat to dry
  • Made in USA

About This Design

Viking Pattern Blue Small Christmas Stocking

Viking Pattern Blue Small Christmas Stocking

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating443 Total Reviews
357 total 5-star reviews65 total 4-star reviews10 total 3-star reviews6 total 2-star reviews5 total 1-star reviews
443 Reviews
Reviews for similar products
5 out of 5 stars rating
By D.December 1, 2021Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Very impressed with the style and size. The pattern is very beautiful
4 out of 5 stars rating
By Leanne S.December 16, 2020Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Very pleased with my order. Arrived well before Christmas and they are larger than expected, which is great. So happy I will have these for years to come. Colours nice, everything spelled correct.
4 out of 5 stars rating
By S.December 23, 2020Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
My daughters love this custom stocking for their guinea pigs’ first Christmas. Shipping was quite slow - only arrived December 23 - not much time up on the mantle before Christmas - but it did arrive before Christmas! nice job - exactly as ordered

Tags

Christmas Stockings
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256886378358240183
Designed on 2017-11-18, 12:42 PM
Rating: G