Tap / click on image to see more RealViewsTM
CA$104.00
per skateboard
 

Viking Pattern Blue Skateboard

Qty:

Other designs from this category

About Skateboards

Sold by

Deck Type: 7 3/4" Skateboard Deck

Whether you're doing grinds on the half-pipe or kickflips in the street, this competition shaped board has supreme pop! Our decks are made of the best quality hard-rock maple and with our one-of-a-kind printing process; you get the best skateboard available in the world.

  • Professional quality skateboard deck made from the very best ingredients
  • Seven plies of premium USA Maple from the Great Lakes region
  • Skateboard specific glue from Franklin.

Complete Your Board: None

Get the fully-equipped board. We’ll include Independent or Krux trucks (based on deck style), Ricta wheels, Bullet bearings, mounting hardware and grip tape.

About This Design

Viking Pattern Blue Skateboard

Viking Pattern Blue Skateboard

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating163 Total Reviews
141 total 5-star reviews14 total 4-star reviews2 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
163 Reviews
Reviews for similar products
5 out of 5 stars rating
By William B.July 25, 2019Verified Purchase
7 3/4" Skateboard Deck
Zazzle Reviewer Program
I was surprised by just how great this board is. Very smooth ride. Perfect. The design has a lot of details and they all came through.
from zazzle.com (US)
5 out of 5 stars rating
By FloWink D.November 12, 2025Verified Purchase
7 3/4" Skateboard Deck
Creator Review
Vivid colors and awesome quality as I expect from Zazzle! .
from zazzle.com (US)
5 out of 5 stars rating
By Yogi S.June 10, 2024Verified Purchase
7 3/4" Skateboard Deck
Excellent quality, design matched the expectation, would highly recommend. Made for display at home - looks great! Perfect - clean and crisp images

Tags

Skateboards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 186963021895698856
Designed on 2017-11-18, 4:53 PM
Rating: G