Tap / click on image to see more RealViewsTM
Sale Price CA$45.35.  
Original Price CA$53.35 per wood art stamp
You save 15%

Viking Pattern Blue Rubber Stamp

Qty:
  1. Size

  2. Handle

  3. Ink Pad colour: None

Other designs from this category

About Wood Art Stamps

Sold by

Size: 5 cm x 5 cm

Put your mark on it. Upload a design, logo, pattern, or text to create a custom maple wood stamp that's all yours. Laser-engraved on a foam cushion for crisp, clean impressions every time. Great for scrapbooking, card making, gift tags, packaging, and any paper craft that needs a personal touch.

  • Available in six sizes
  • Optional wooden handle for easier stamping
  • Optional Color Box® permanent ink pad (10.2 cm L x 1.3 cm W x 6.4 cm H, raised pad surface)
  • Additional Color Box® ink pad colors available here
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.3K Total Reviews
2791 total 5-star reviews267 total 4-star reviews73 total 3-star reviews56 total 2-star reviews79 total 1-star reviews
3,266 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By HilarySeptember 8, 2023 • Verified Purchase
5 cm x 5 cm Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = No Handle
Zazzle Reviewer Program
I use this stamp on paper, and on wood. So happy I ordered it. The archival ink pad included works very well with the stamp! Exquisite detail, & clean print.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tarandeep M.September 25, 2021 • Verified Purchase
6.4 cm x 6.4 cm Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = Wooden Handle
Zazzle Reviewer Program
Custom rubber stamps are soooo expensive when it comes to large sizes that I needed for my small business. From placing my order to receiving my stamp, everything was easy and fast. The stamp is excellent quality and I use it regularly for my Puraka Studios small business. I am so pleased that I will be ordering another stamp from them soon. Don't look anywhere else. Crisp and perfect just like the my logo.
5.0 out of 5 stars rating
5 out of 5 stars rating
By NicoleOctober 3, 2023 • Verified Purchase
5 cm x 5 cm Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = Wooden Handle
Zazzle Reviewer Program
Easy to use and great quality! The colours were exactly what was shown online. The stamp looks like our business logo with no missing edges or curves

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Designed on 2017-11-20, 11:38 AM
Rating: G