Tap / click on image to see more RealViewsTM
CA$48.20
per wood art stamp
 

Viking Pattern Blue Rubber Stamp

Qty:
Wooden Handle
-CA$2.70
None
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95
+CA$22.95

Other designs from this category

About Wood Art Stamps

Sold by

Size: 5 cm x 5 cm

Transform any craft project with a personalised maple wood stamp. Leave an impression by uploading a design, image, pattern, or text to make your unique stamp.

  • Available in six sizes
  • Laser engraved on foam cushion
  • Optional wooden handle
  • Optional Colour Box® ink pad is permanent ink for scrapbooking and paper craft projects
  • Additional Colour Box® ink pads in a variety of colours can be found by following this Link
  • Ink pad size: 10.16 cm L x 6.35 cm W x 1.27 cm D
  • Raised pad surface
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.2K Total Reviews
2745 total 5-star reviews264 total 4-star reviews70 total 3-star reviews46 total 2-star reviews66 total 1-star reviews
3,191 Reviews
Reviews for similar products
4 out of 5 stars rating
By jungko c.April 23, 2021Verified Purchase
Zazzle Reviewer Program
I have been using mine for quite some time and the details are still fine. It is exactly how my logo looks like including the small stars. It just needs more balance in the middle. meaning if I will not stamp hard then it won't capture the middle part. I couldn't bring it back out of inconvenience. But I have ordered 7 stamps in total and yet I love them all. In fact, I will be creating a blog and review about my stamp and how I love Zazzle for my business ideas! Shipping to Canada takes more time due to Covid-19 Pandemic but considering that it is still fast! I just wish they can make a 1x1 size and a bigger one up to 10 x 10. I just have to stamp hard to get all the prints out, it doesn't hinder its function, so I would give it 4 stars.
5 out of 5 stars rating
By H.September 8, 2023Verified Purchase
Zazzle Reviewer Program
I use this stamp on paper, and on wood. So happy I ordered it. The archival ink pad included works very well with the stamp! Exquisite detail, & clean print.
5 out of 5 stars rating
By Tarandeep M.September 25, 2021Verified Purchase
Zazzle Reviewer Program
Custom rubber stamps are soooo expensive when it comes to large sizes that I needed for my small business. From placing my order to receiving my stamp, everything was easy and fast. The stamp is excellent quality and I use it regularly for my Puraka Studios small business. I am so pleased that I will be ordering another stamp from them soon. Don't look anywhere else. Crisp and perfect just like the my logo.

Tags

Wood Art Stamps
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Designed on 2017-11-20, 11:38 AM
Rating: G