Tap / click on image to see more RealViewsTM
CA$13.70
per pad
 

Viking Pattern Blue Post-it Notes

Qty:
10.2 cm x 7.6 cm
+CA$8.60
-CA$1.70
+CA$24.10

Other designs from this category

About Post-it® Notes

Sold by

Size: Post-it® Notes 10.2 cm x 7.6 cm

When your mind is brimming with to-dos, keep it together with a pad of custom 3M Post-it® Notes. Jot down urgent memos, lists, or a sweet note to special someone such as, "Do NOT forget the milk!" Each 10.1 cm x 7.6 cm pad comes with 50 sticky notes printed in full colour with your graphics, text, or photos. If Post-it® Notes are going to be on your desk anyway, they might as well be creatively personal.

  • Authentic 3M Post-it® Notes
  • Dimensions: 10.1 cm x 7.6 cm (Adhesive side: 10.1 cm edge)
  • Printed in full colour on 50-sheet white Post-it® Notes paper
  • Buy in bulk and save
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.1 cm x 7.1 cm. For best results please add 0.15 cm (.12") bleed..

About This Design

Viking Pattern Blue Post-it Notes

Viking Pattern Blue Post-it Notes

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating1.9K Total Reviews
1670 total 5-star reviews174 total 4-star reviews33 total 3-star reviews9 total 2-star reviews14 total 1-star reviews
1,900 Reviews
Reviews for similar products
5 out of 5 stars rating
By Eulanda S.February 27, 2024Verified Purchase
Post-It® Notes, 10.2 cm x 15.2 cm
Zazzle Reviewer Program
The saying I had added on these post-it notes is a perfect way to slap one inside a handmade card and then have the recipient be able to re-use it. The sizing that Zazzle offered was perfect!! The printing and colouring looked very much the same as it did on screen. There were no surprises. LOL! I will be ordering again!!
5 out of 5 stars rating
By K.December 13, 2020Verified Purchase
Post-It® Notes, 10.2 cm x 7.6 cm
Zazzle Reviewer Program
I honestly did not expect it to be as good as it was! It is the actual Post-It brand so it is amazing quality. The printing was a bit smaller than I expected, but that was my poor judgement when creating. The color turned out perfect. Can’t wait to gift this!
5 out of 5 stars rating
By Liane M.October 25, 2022Verified Purchase
Post-It® Notes, 10.2 cm x 15.2 cm
Zazzle Reviewer Program
The paper is good quality. I need to make the print bigger. I found it hard to see with the actual size on the website

Tags

Post-it® Notes
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256866823467017474
Designed on 2017-11-19, 10:08 AM
Rating: G