Tap / click on image to see more RealViewsTM
CA$30.00
CA$3.75 per paper plate
 

Viking Pattern Blue Paper Plate

Qty:
17.78 cm Round Paper Plate
+CA$0.20
+CA$0.20

Other designs from this category

About Paper Plates

Sold by

Size and Style: 17.78 cm Round Paper Plate

Throw a spectacular party with fully customizable paper plates to match your theme! Each set of eight paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving cake, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 17.8 cm diameter
  • FDA compliant for food contact safety
  • Perfect for cake, appetizers, or salads
  • Printed in USA

About This Design

Viking Pattern Blue Paper Plate

Viking Pattern Blue Paper Plate

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating1.4K Total Reviews
1117 total 5-star reviews100 total 4-star reviews46 total 3-star reviews41 total 2-star reviews69 total 1-star reviews
1,373 Reviews
Reviews for similar products
5 out of 5 stars rating
By Vivian A.November 12, 2021Verified Purchase
Paper Plates, 17.78 cm Round Paper Plate
Zazzle Reviewer Program
I ordered this for my baby’s first bday party. Came on time and looked so cute! Quality is pretty good too. Everyone saw the plate and didn’t want to use it! Happy with this purchase overall! Great. Exactly as described.
5 out of 5 stars rating
By Valerie R.October 23, 2023Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Zazzle Reviewer Program
Plates were soooo cute and adorable! Everyone thot it was so cute. Everything turned out and we had enough plates but Inbetween the plates I ordered there were a few plates of someone else’s. So we had 7 plates that weren’t for this shower and it must have been someone else’s plates but we had enough for the people that came.
5 out of 5 stars rating
By Harmony S.June 18, 2022Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Creator Review
Great accent for an outdoor summer party. Bright colors, vibrant floral design

Tags

Paper Plates
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256625107117526098
Designed on 2017-11-18, 11:39 AM
Rating: G