Tap / click on image to see more RealViewsTM
CA$29.20
per spiral notebook
 

Viking Pattern Blue Notebook

Qty:
21.6 cm x 27.9 cm
Wide Ruled
Black

Other designs from this category

About Spiral Notebooks

Sold by

Style: 21.6 cm x 27.9 cm

Accessorize while you organize with these hand made spiral notebooks. The front and back covers are customizable with your images and text, and the notebook covers are laminated to ensure durability. Choose from 4 notebook styles, hardcover or softcover versions, 7 different spiral colors and 10 page design options to make your one-of-a-kind notebook today.

  • Dimensions: 21.6 cm l x 28 cm w
  • Hardcover or Softcover
  • Page Count: 60 sheets, 120 pages
  • 60 lb. durable text smooth paper
  • Laminated front and back covers, plain white inside
  • Choice of 7 colors for the spiral
  • Choice of 10 designs for the pages
  • CPSIA compliant
  • Suitable for ages 4+

About This Design

Viking Pattern Blue Notebook

Viking Pattern Blue Notebook

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating842 Total Reviews
758 total 5-star reviews58 total 4-star reviews8 total 3-star reviews3 total 2-star reviews15 total 1-star reviews
842 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kendra M.January 6, 2025Verified Purchase
21.6 cm x 21.6 cm, Black spiral, Wide Ruled pages
Absolutely beautiful! It’s more stunning in person. Amazing quality from the hardcover (images/font) to the pages. I love it! 😍 I will definitely order again in the future and I highly recommend any potential buyers to purchase. You won’t be disappointed. Thank you Zazzle. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Elena F.December 8, 2022Verified Purchase
14.0 cm x 21.6 cm, Black spiral, College Ruled pages
Zazzle Reviewer Program
This journal came in within a week of ordering it and I was thrilled! I love roses so I love having this journal. The size is perfect. Small enough to throw in a bag. The printing is clear. The pages are nice and thick. The binding is sturdy. The printing is a little darker than the photo on screen but that is expected with printing. It looks luxurious to me. I love deep red roses.
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.May 2, 2022Verified Purchase
21.6 cm x 27.9 cm, Black spiral, Wide Ruled pages
Zazzle Reviewer Program
Speedy delivery, book is hard-covered, beautiful and very-well made! My daughter is using it for her favourite recipes and it will be kept for years. The printing was perfect, done exactly to specifications.

Tags

Spiral Notebooks
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256901698435672199
Designed on 2017-11-19, 10:12 AM
Rating: G