Tap / click on image to see more RealViewsTM
CA$77.80
per set of 50 napkins
 

Viking Pattern Blue Napkin

Qty:
White

Other designs from this category

About Paper Napkins

Sold by

Style: Coined Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalized paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 cm w (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Viking Pattern Blue Napkin

Viking Pattern Blue Napkin

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.1K Total Reviews
2617 total 5-star reviews240 total 4-star reviews79 total 3-star reviews58 total 2-star reviews111 total 1-star reviews
3,105 Reviews
Reviews for similar products
5 out of 5 stars rating
By D.July 22, 2022Verified Purchase
Paper Napkins, Standard Luncheon
Zazzle Reviewer Program
Napkins are soft, design is exactly as imaged online, fast shipping, overall highly recommended. Colours and usage quality was great!
5 out of 5 stars rating
By C.March 26, 2024Verified Purchase
Paper Napkins, Standard Cocktail
The napkins were amazing. They were a huge hit at our event. I love that you can customize them and they are great quality. The printing was great quality and exactly what I expected.
5 out of 5 stars rating
By R.March 26, 2023Verified Purchase
Paper Napkins, Standard Luncheon
Zazzle Reviewer Program
The product was chosen as a theme and as a result of the exceptional quality it quickly became the eye catching part of our decorations. Pleasing all generations the soft paper looked like linen and served a very useful purpose and easy to recycle. Clear, concise and conveyed the message while serving a useful purpose.

Tags

Paper Napkins
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256214417618707333
Designed on 2017-11-18, 4:46 PM
Rating: G