Tap / click on image to see more RealViewsTM
CA$20.05
per tag
 

Viking Pattern Blue Luggage Tag

Qty:

Other designs from this category

About Luggage Tags

Sold by

Style: Double-sided

Stand out in a crowd at the baggage carousel with a custom luggage tag from Zazzle! Sturdy and weatherproof, this luggage tag is ready to stand up to the travel demands of any road warrior or adventure seeker. Printed using the AcryliPrint®HD printing process, your baggage tag shows designs, text, and photos in vibrant clarity and brilliant colors. Customise it with your information and escape bag mix-ups for years to come!

  • Dimensions: 5.1 cm l x 8.9 cm w (standard business card size)
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
  • Leather luggage strap included
  • Printed on both sides
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Luggage Tag

Viking Pattern Blue Luggage Tag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating4.5K Total Reviews
4071 total 5-star reviews292 total 4-star reviews77 total 3-star reviews20 total 2-star reviews29 total 1-star reviews
4,489 Reviews
Reviews for similar products
5 out of 5 stars rating
By Darren W.March 20, 2023Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
Designing and ordering your own unique product was easy and simple. Shipping updates and delivery were both smooth and efficient. Over delivered in my opinion! Friends commented and loved the product! The design was exactly as I had ordered it. The clarity and precision were exact. The app really made a live sample you could see before ordering. Solid material and durable for travel.
5 out of 5 stars rating
By C.December 11, 2019Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
Good quality! Excellent design! These are a gift and they will love them! Love the colors and quality! Turned out just like I expected!
5 out of 5 stars rating
By F.December 18, 2023Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
My husband was very happy with his present. Very sturdy. Well made and just like the picture on the website. Very good. Easy to read. My mistake on printing not putting the country on the tag.

Tags

Luggage Tags
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256722126263163913
Designed on 2017-07-28, 10:01 PM
Rating: G