Tap / click on image to see more RealViewsTM
CA$45.70
per flask
 

Viking Pattern Blue Hip Flask

Qty:
177 ml

Other designs from this category

About Flask

Sold by

Size: Vinyl Wrapped Flask, 177ml.

Be prepared and discreet with a custom Liquid Courage™ flask. A unique gift that's perfect for weddings, birthdays, and special events!

  • Dimensions: 3.75"l x 4.5"w x 1"d; 6 oz. (9.5 cm (L) x 11.4 cm (W) x 2.5 cm (D); 177 ml)
  • Material: Stainless steel flask with attached screw top lid
  • Printed on high-quality vinyl that is securely wrapped
  • Durable, water and fade resistant
  • Hand wash with warm water
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 3.7" x 8.3"( 9.4 cm x 21.1 cm). For best results please add 3/7" (1.1cm) bleed.

About This Design

Viking Pattern Blue Hip Flask

Viking Pattern Blue Hip Flask

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating397 Total Reviews
342 total 5-star reviews46 total 4-star reviews5 total 3-star reviews3 total 2-star reviews1 total 1-star reviews
397 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sara D.September 15, 2017Verified Purchase
Vinyl Wrapped Flask
Zazzle Reviewer Program
We bought these as favours for our wedding my husband was jealous that we didnt also get one for him. The flask it self was in fact a flask. It does everything a flask should. Great size amd weight. The product looked exaclty like the picture
5 out of 5 stars rating
By D W.January 14, 2023Verified Purchase
Vinyl Wrapped Flask
Zazzle Reviewer Program
I was so impressed with not only the end result but the professionalism and speed of communication. These are better than what I could have hoped for, High quality. Everythibg I ordered was perfect
5 out of 5 stars rating
By D R.October 19, 2023Verified Purchase
Vinyl Wrapped Flask
Zazzle Reviewer Program
The service and the product was everything that I expected and more. Great I don’t have a picture because I gave it as a gift. The person that got it loves it. He shows it every time someone get a birdie and he give them a shot. A GREAT GOLF GIFT. CHEERS ZAZZLE

Tags

Flask
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256200989444562947
Designed on 2017-11-18, 12:57 PM
Rating: G