Tap / click on image to see more RealViewsTM
CA$1.70  per flyer
CA$42.50 Subtotal
 

Viking Pattern Blue Flyer

Qty:
Thin Matte Paper
-CA$0.09

Other designs from this category

About Flyers

Sold by

Size: 8.5" x 11"

Make your promotional materials stand out with a custom flyer. The perfect size for all of your promotional needs, you can upload your own photos, graphics, and logos to craft the perfect flyers for your event, party, or grand opening.

  • Dimensions: 8.5" L x 11" W
  • Larger than quarter-page size
  • High quality, full-color, full-bleed printing
  • Customize both sides at no extra cost
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 8.5" x 11". For best results please add 1/16" bleed

Paper Type: Thin Matte Paper

Your flyers, sell sheets and promotions will pop off the page on this glossy, vibrant, 110lb cover-weight paper. Our basic paper contains 50% recycled content.

About This Design

Viking Pattern Blue Flyer

Viking Pattern Blue Flyer

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating815 Total Reviews
683 total 5-star reviews87 total 4-star reviews20 total 3-star reviews5 total 2-star reviews20 total 1-star reviews
815 Reviews
Reviews for similar products
5 out of 5 stars rating
By Cheri M.October 4, 2021Verified Purchase
Flyer Paper, Size: 8.5" x 11", Paper: Thin Matte Paper
Zazzle Reviewer Program
Love the flyer, was able to customize it for my needs easily, Flyer arrived quickly and was very to look at with its vibrate colors and easy-to-read layout. Printing was very clear and easy to read
5 out of 5 stars rating
By Tamara L.February 11, 2024Verified Purchase
Flyer Paper, Size: 8.5" x 11", Paper: Thin Matte Paper
Zazzle Reviewer Program
Exactly what I wanted. Clear print and easy to read
5 out of 5 stars rating
By Rosangela M.July 16, 2019Verified Purchase
Flyer Paper, Size: 8.5" x 11", Paper: Thin Glossy Paper
Zazzle Reviewer Program
In such difficult moments zazzle over did themselves. As I was looking for my grandpas funeral arrangements I came across this product and thought it would be perfect. The funeral home sells stationary for $200 and zazzle gave me a great product for much less. Highly recommend. Just as I wrote it in the computer
from zazzle.com (US)

Tags

Flyers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 244564746715675103
Designed on 2017-11-20, 11:48 AM
Rating: G