Tap / click on image to see more RealViewsTM
CA$101.00
per fleece blanket
 

Viking Pattern Blue Fleece Blanket

Qty:

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 127 cm x 152.4 cm

It’s hard to cuddle by yourself. But with these fully customisable comfy fleece blankets, you won’t have to anymore. Customise the entire front panel and wrap yourself in personalised plush luxury. Delicate, soft and colourful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small (76.2 cm x 101.6 cm); medium(127 cm x 152.4 cm); large(152.4 cm x 203.2 cm).
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy double edge stitching for a clean finish
  • Back colour is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Viking Pattern Blue Fleece Blanket

Viking Pattern Blue Fleece Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating3.4K Total Reviews
2980 total 5-star reviews339 total 4-star reviews60 total 3-star reviews45 total 2-star reviews24 total 1-star reviews
3,448 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ashley H.December 11, 2021Verified Purchase
Fleece Blanket, Large 152.4 cm x 203.2 cm
Zazzle Reviewer Program
Product is great quality, arrived on time, it will be enjoyed for a long time!! Exactly what I ordered
5 out of 5 stars rating
By S.February 13, 2021Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm
Zazzle Reviewer Program
Beautiful product of. Amazing good quality picture were clear
5 out of 5 stars rating
By Gervanne B.December 30, 2017Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm
Zazzle Reviewer Program
I absolutely love it. It is amazing, and warm, and soft, softer I would have ever expected, it does not look cheap at all, it is just the best blanket ever, I love wrapping my self in it. I will probably buy some for my friends. The printing is just as perfect, it is very readable, the colours came out perfectly, with the right nuances and gradients... I love everything about it.

Tags

Fleece Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256478076938277373
Designed on 2017-11-18, 12:45 PM
Rating: G