Tap / click on image to see more RealViewsTM
CA$107.00
per fleece blanket
 

Viking Pattern Blue Fleece Blanket

Qty:
  1. Size

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 127 cm x 152.4 cm

It’s hard to cuddle by yourself. But with these fully customisable comfy fleece blankets, you won’t have to anymore. Customise the entire front panel and wrap yourself in personalised plush luxury. Delicate, soft and colourful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small (76.2 cm x 101.6 cm); medium(127 cm x 152.4 cm); large(152.4 cm x 203.2 cm).
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy double edge stitching for a clean finish
  • Back colour is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Viking Pattern Blue Fleece Blanket

Viking Pattern Blue Fleece Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating3.6K Total Reviews
3091 total 5-star reviews346 total 4-star reviews68 total 3-star reviews51 total 2-star reviews32 total 1-star reviews
3,588 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnnetteApril 24, 2024Verified Purchase
Fleece Blanket, 76.2 cm x 101.6 cm
Ideal personalized gift for anyone, any occasion, but especially for people either Dementia or Alzheimer's. Ordered one for my dad for his 75th birthday. Size options, quality material, soft, warm. Pictures turned out amazing. My dad can get to see his loved ones and be wrapped up in the memories.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Gervanne B.December 30, 2017Verified Purchase
Fleece Blanket, 76.2 cm x 101.6 cm
Zazzle Reviewer Program
I absolutely love it. It is amazing, and warm, and soft, softer I would have ever expected, it does not look cheap at all, it is just the best blanket ever, I love wrapping my self in it. I will probably buy some for my friends. The printing is just as perfect, it is very readable, the colours came out perfectly, with the right nuances and gradients... I love everything about it.
5.0 out of 5 stars rating
5 out of 5 stars rating
By NicoleDecember 30, 2023Verified Purchase
Fleece Blanket, 127 cm x 152.4 cm
Zazzle Reviewer Program
Soft texture, good size for value, and clear images even though photo quality was less than ideal. Pleasantly surprised by quality. Exceptionally clear for photo quality.

Tags

Fleece Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256478076938277373
Designed on 2017-11-18, 12:45 PM
Rating: G