Tap / click on image to see more RealViewsTM
CA$31.95
per ornament
 

Viking Pattern Blue Ceramic Ornament

Qty:
Ceramic Heart Ornament
-CA$5.20
-CA$5.20
-CA$5.20
-CA$6.90
-CA$6.90
-CA$6.90
-CA$1.75
-CA$1.75
-CA$1.75
+CA$8.60
+CA$8.60

Other designs from this category

About Ornaments

Sold by

Style: Ceramic Heart Ornament

Bring a lot more holiday cheer to your tree with a custom ceramic ornament. Add family photos, images and personal message to both sides of this ornament. A strand of gold thread makes it easy to hang this fantastic keepsake.

  • Dimensions: 7.6 cm l x 7.1 cm w; Weight: 39 g.
  • Made of white porcelain
  • Full-colour, full-bleed printing
  • Printing on both sides
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 7.6 cm x 7.1 cm. For best results please add 0.3 cm (1/8") bleed.

About This Design

Viking Pattern Blue Ceramic Ornament

Viking Pattern Blue Ceramic Ornament

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating11.9K Total Reviews
9712 total 5-star reviews1317 total 4-star reviews388 total 3-star reviews179 total 2-star reviews293 total 1-star reviews
11,889 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.November 3, 2023Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
Very pleased with this item. I purchased it as a keepsake of my recent cruise around Spain. I placed my order on Monday and it arrived on Friday. That's fast considering I live in Alberta and it shipped from New York. The front was colorful and exactly as illustrated. The customization I requested on the back was perfect!
5 out of 5 stars rating
By J.December 28, 2019Verified Purchase
Ceramic Circle Ornament
Zazzle Reviewer Program
I orders this ornament as a gift for my daughter. It turned out exactly as I was hoping, very happy with the quality. Delivery was quick, received within a week ( shipped to Canada). Image quality was excellent.
3 out of 5 stars rating
By Matt D.December 21, 2025Verified Purchase
Glass Circle Ornament
It came fast and exactly as I did it except 2 were minorly scratched and I ordered 8 and only got 7 and only 6 bags. .

Tags

Ornaments
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 175880270232656110
Designed on 2017-11-18, 12:03 PM
Rating: G