Tap / click on image to see more RealViewsTM
CA$33.95
per ornament
 

Viking Pattern Blue Ceramic Ornament

Qty:
Ceramic Heart Ornament
-CA$5.45
-CA$5.45
-CA$5.45
-CA$7.30
-CA$7.30
-CA$7.30
-CA$1.80
-CA$1.80
-CA$1.80
+CA$9.15
+CA$9.15

Other designs from this category

About Ornaments

Sold by

Style: Ceramic Heart Ornament

Bring a lot more holiday cheer to your tree with a custom ceramic ornament. Add family photos, images and personal message to both sides of this ornament. A strand of gold thread makes it easy to hang this fantastic keepsake.

  • Dimensions: 7.6 cm l x 7.1 cm w; Weight: 39 g.
  • Made of white porcelain
  • Full-colour, full-bleed printing
  • Printing on both sides
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 7.6 cm x 7.1 cm. For best results please add 0.3 cm (1/8") bleed.

About This Design

Viking Pattern Blue Ceramic Ornament

Viking Pattern Blue Ceramic Ornament

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating11.4K Total Reviews
9421 total 5-star reviews1296 total 4-star reviews349 total 3-star reviews143 total 2-star reviews228 total 1-star reviews
11,437 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.November 3, 2023Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
Very pleased with this item. I purchased it as a keepsake of my recent cruise around Spain. I placed my order on Monday and it arrived on Friday. That's fast considering I live in Alberta and it shipped from New York. The front was colorful and exactly as illustrated. The customization I requested on the back was perfect!
5 out of 5 stars rating
By J.December 28, 2019Verified Purchase
Ceramic Circle Ornament
Zazzle Reviewer Program
I orders this ornament as a gift for my daughter. It turned out exactly as I was hoping, very happy with the quality. Delivery was quick, received within a week ( shipped to Canada). Image quality was excellent.
5 out of 5 stars rating
By Denis S.August 15, 2023Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
This is my go to wedding gift for people that have everything. The printing is perfect, looks exactly like what I wanted

Tags

Ornaments
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 175880270232656110
Designed on 2017-11-18, 12:03 PM
Rating: G