Tap / click on image to see more RealViewsTM
CA$18.20
each
 

Viking Pattern Blue Ceramic Knob

Qty:
Ceramic Knob

Other designs from this category

About Ceramic Pulls

Sold by

Style: Ceramic Knob

Spruce up cabinets and furniture and take your decorating game to the next level by customizing your own knobs. From the kitchen to your child’s bedroom, custom knobs are the perfect accent that can complement any décor.

  • Beautiful 3.8 cm wide white ceramic knobs.
  • Standard size; fits most 3.2 cm diameter holes.
  • Easy installation.
  • Includes screw. No additional hardware required.
  • Great for cabinets, drawers, and furniture.
  • Perfect finishing touch to bedrooms, kitchens, DIY projects and more!
  • This product has small parts and is not a toy. Not recommended for children 8 and below.

About This Design

Viking Pattern Blue Ceramic Knob

Viking Pattern Blue Ceramic Knob

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating229 Total Reviews
205 total 5-star reviews13 total 4-star reviews2 total 3-star reviews2 total 2-star reviews7 total 1-star reviews
229 Reviews
Reviews for similar products
5 out of 5 stars rating
By Donna R.March 11, 2019Verified Purchase
Ceramic Knob
Creator Review
These little ceramic knobs are adorable. They will enhance any dresser or cabinet. It's like a renovation for a fraction of the cost. Beautiful. The flower photo was gorgeous and vibrant.
5 out of 5 stars rating
By Sharon F.April 20, 2023Verified Purchase
Ceramic Knob
Creator Review
I have created and ordered hundreds of knobs on my Zazzle store, and I've been thrilled with all. The fairy series though is exceptional. Sure, the clarity on my porthole windows, seashells, etc. was perfect; yet, when I opened the package and saw these, I was mesmerized. I stared at them off and on all night wondering how they could print such beautiful absolutely perfect details without a flaw ... the color, the eyes, the overall product considering how small the knobs are and how detailed the little fairies are which cannot be seen in my photos even. These are perfect for a child's room, for furniture to give a Victorian look, and I am ordering the entire series to eventually use on a dresser as well as wood strips (2 or 3 at a time) to make hangers for jewelry and clothing. If yours turn out like mine, you'll be amazed. My photos do not do the knobs justice. Another Zazzle hit above and beyond perfection! I keep asking myself how they did it. Yes, to print an anchor or seashell on a small ceramic knob has always been beautiful with Zazzle; yet, how on earth did they catch every detail in the eyes, face, etc. of these? Kudos to the printers! Again, my photos do not do the knobs justice. The product is exactly as the photo you see on the product page for sale.
from zazzle.com (US)
4 out of 5 stars rating
By J.March 29, 2018Verified Purchase
Ceramic Knob
Zazzle Reviewer Program
We used this as the handle for a box we made to hold our clients beloved Springer's ashes. The wording and image was perfect for the application. The clarity of the image is descent for the size.
from zazzle.com (US)

Tags

Ceramic Pulls
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256139192633319931
Designed on 2017-11-18, 12:54 PM
Rating: G