Tap / click on image to see more RealViewsTM
CA$18.00
CA$9.00 each
 

Viking Pattern Blue Black Ink Pen

Qty:
Black
Black

Other designs from this category

About Pens

Sold by

Writing Ink Colour: Black Ink Pen

Just because we all have smart phones and laptops doesn't mean the written word is on its way out. In fact, it means just that much more to receive a personal handwritten note! Arm yourself with your own writing mechanism by customising your own one-of-a-kind pen, and continue to make statements in the good ol' fashioned way.

  • Minimum order of 2.
  • Click into action with your own one-of-a-kind pen.
  • Available in multiple colour inks & trim accents.
  • Printed in full vibrant colour that is sure to wow.
  • Extended life writing cartridges.
  • Proudly made in the USA.
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.2 cm x 3.4 cm. For best results please add 0.6 cm bleed.

About This Design

Viking Pattern Blue Black Ink Pen

Viking Pattern Blue Black Ink Pen

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating475 Total Reviews
405 total 5-star reviews47 total 4-star reviews11 total 3-star reviews6 total 2-star reviews6 total 1-star reviews
475 Reviews
Reviews for similar products
5 out of 5 stars rating
By K.February 24, 2022Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
When I first ordered this product, the ink was not very good. I called the customer service department and told them. They issued a full credit to my account, and I ordered 25 new pens, and they are great! I am receiving many compliments about my new pens. Zazzle has an excellent customer service department where people listen and help. Thank you. Yes, all worked out great!
5 out of 5 stars rating
By Victoria M.November 27, 2020Verified Purchase
Red Trim Pen, Black Ink
Zazzle Reviewer Program
This pen is the cutest gift for a teacher. It writes smoothly with the colour I chose and met my expectations perfectly. Colours, name and mini images came out better than I anticipated. I highly recommend. I would like to buy myself so many more.
5 out of 5 stars rating
By Jennifer T.April 29, 2020Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
The pens are amazing and came right on time!!! Such an easy process and they look amazing! My husband loves them! Looks amazing! Printed out great! Exactly as I wanted

Tags

Pens
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256923905525289734
Designed on 2017-11-20, 11:38 AM
Rating: G