Tap / click on image to see more RealViewsTM
CA$43.55
per mug
 

Viking Pattern Blue Beer Stein

Qty:
  1. Style

  2. Size

  3. colour: Gray/Blue

Other designs from this category

About Mugs

Sold by

Style: Stein

Don't just drink beer, celebrate it with a made-to-order Zazzle beer stein. Our traditional German beer mug features ornate borders at the rim and base and a detailed handle. Honour your beer with the right vessel for the job, or give a stein to the beer lover in your life.

  • Available in 2 colours – white with metallic gold and grey with blue
  • Dimensions:
    • Grey/Blue 650 ml: 7.6 cm diameter x 16.8 cm height
    • White/Gold 590 ml: 7.6 cm diameter x 16.8 cm height
  • Hand wash only
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Viking Pattern Blue Beer Stein

Viking Pattern Blue Beer Stein

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating704 Total Reviews
587 total 5-star reviews83 total 4-star reviews17 total 3-star reviews7 total 2-star reviews10 total 1-star reviews
704 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Brad O.February 9, 2017Verified Purchase
Frosted Glass Mug, 473 ml
Zazzle Reviewer Program
Great Product. Excellent work. A++++. Printing color was perfect. Turned out better than expected.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Brad O.February 14, 2017Verified Purchase
Frosted Glass Mug, 473 ml
Zazzle Reviewer Program
Great print and quality....love it. Great print. Very clear..
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kimball M.June 26, 2019Verified Purchase
Stein, Blue/Grey 625 ml / White/Gold 570 ml
Creator Review
My friends enjoyed this present I made for them. Great printing as always!
from zazzle.com (US)

Tags

Mugs
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 168214304985240400
Designed on 2017-11-18, 1:05 PM
Rating: G