Tap / click on image to see more RealViewsTM
CA$23.70
per bottle opener
 

Viking Pattern Blue Bar Key

Qty:
Speed Bottle Opener
-CA$1.80
-CA$1.80

Other designs from this category

About Bottle Openers

Sold by

Style: Speed Bottle Opener

Pop those bottles like a pro! Used by bartenders, this professional stainless steel speed bottle opener has the length and design to open bottles with speed and ease. Customise yours with images, designs and text for a unique opener that shows off your style. Great as a gift for aspiring bartenders or for friends that like a good drink (or two)!

  • Dimensions: 3.8 cm w x 17.7 cm l x 0.3 cm h.
  • All over printing with protective coating.
  • Spinner ring included.
  • Stainless steel construction for extra durability.
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 4 cm x 17.7 cm (1.6" x 7"). For best results please add 0.2 cm (1/11") bleed.

About This Design

Viking Pattern Blue Bar Key

Viking Pattern Blue Bar Key

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating228 Total Reviews
196 total 5-star reviews25 total 4-star reviews4 total 3-star reviews2 total 2-star reviews1 total 1-star reviews
228 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.November 28, 2019Verified Purchase
Mini Bottle Opener With Keychain
Zazzle Reviewer Program
I’m so happy with how well this turned out! A little bit bigger than I expected but it works perfectly :). So easy to customize and the image quality is impressive!
5 out of 5 stars rating
By C.March 20, 2022Verified Purchase
Credit Card Bottle Opener
Zazzle Reviewer Program
Perfect gift for the perfect us! Picture is clear and bright
5 out of 5 stars rating
By Andrea O.March 2, 2020Verified Purchase
Speed Bottle Opener
Zazzle Reviewer Program
Got this as a gift and my friend was in love! I was told the bar key is super durable and easy to use! Got one for my self soon after! I added 3 pictures and all 3 looked really clear, not blurry at all and there was no bleed. Added some text as well and the font was perfect!
from zazzle.com (US)

Tags

Bottle Openers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256192524466145680
Designed on 2017-11-18, 1:09 PM
Rating: G