Tap / click on image to see more RealViewsTM
CA$88.95
per banner
 

Viking Pattern Blue Banner

Qty:

Other designs from this category

About Banners

Sold by

Size: 91cm x 152cm Banner

Shout it from the rooftops, say it big and bold - it's time to get the word out! Indoors or out, our banners are here to help you advertise anything, from birthdays to graduation, weddings to anniversaries. We've got thousands of designs for you to browse through, along with 4 different size options.

  • Dimensions: 0.9 m l x 1.5 m w (horizontal) or 1.5 m l x 0.9 m w (vertical)
  • Edge-to-edge, full colour vibrant print for a bold statement
  • Hemmed and thermally welded edges for neat finish
  • Choice of indoor or outdoor banners. Outdoor banners can be bought with metal grommets

Material: Indoor

Lightweight and durable, our 368 g (13 oz) vinyl material is best suited for indoor or short-term outdoor events. This white flexible material comes with an elegant matte finish, and is both fade and tear resistant.

About This Design

Viking Pattern Blue Banner

Viking Pattern Blue Banner

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2.3K Total Reviews
2110 total 5-star reviews91 total 4-star reviews35 total 3-star reviews15 total 2-star reviews42 total 1-star reviews
2,293 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lynne M.September 13, 2022Verified Purchase
Vinyl Banner, 76cm x 183cm, Indoor
Zazzle Reviewer Program
Customization of the banner was very easy (even after multiple edits) and having a preview of the customization made me a lot more at ease about placing an order. I was afraid that the banner would arrived folded up in a small box and would have unsightly creases, however, that wasn't the case at all. The banner arrived in a sturdy cardboard triangular tube and was crease-free. I was pleasantly surprised with the overall quality of the materials. I was expecting it to be less but it appears to be very good quality (thick vinyl with properly installed metal grommets) and I would expect it to be long lasting. I would definitely recommend this product. The printing turned out beautifully; everything was lined up as I was expecting based on the preview. The ink had a uniform opaque appearance throughout (you couldn't see any white of the vinyl though it). Extremely professional looking.
5 out of 5 stars rating
By Louna H.October 8, 2022Verified Purchase
Vinyl Banner, 0.6m x 0.3m, Indoor
Zazzle Reviewer Program
I bought this product for my pop up market and like always zazzle never disappoints me it was excellent the colors and the materials were extremely well done I love dealing with zazzle. Everything was perfect the colors the size the materials it was exactly like the demo picture
5 out of 5 stars rating
By Lisa C.May 26, 2021Verified Purchase
Vinyl Banner, 76cm x 183cm, Indoor
Zazzle Reviewer Program
I was very happy with the banner for my daughters first birthday . It was donut ( sweet one theme) . The banner was awesome quality . I rolled it up and saved it for her next birthday ! Printing was perfect

Tags

Banners
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256325634972916561
Designed on 2017-11-20, 11:22 AM
Rating: G