Tap / click on image to see more RealViewsTM
CA$88.95
per banner
 

Viking Pattern Blue Banner

Qty:

Other designs from this category

About Banners

Sold by

Size: 91cm x 152cm Banner

Shout it from the rooftops, say it big and bold - it's time to get the word out! Indoors or out, our banners are here to help you advertise anything, from birthdays to graduation, weddings to anniversaries. We've got thousands of designs for you to browse through, along with 4 different size options.

  • Dimensions: 0.9 m l x 1.5 m w (horizontal) or 1.5 m l x 0.9 m w (vertical)
  • Edge-to-edge, full colour vibrant print for a bold statement
  • Hemmed and thermally welded edges for neat finish
  • Choice of indoor or outdoor banners. Outdoor banners can be bought with metal grommets

Material: Indoor

Lightweight and durable, our 368 g (13 oz) vinyl material is best suited for indoor or short-term outdoor events. This white flexible material comes with an elegant matte finish, and is both fade and tear resistant.

About This Design

Viking Pattern Blue Banner

Viking Pattern Blue Banner

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2.3K Total Reviews
2087 total 5-star reviews89 total 4-star reviews34 total 3-star reviews13 total 2-star reviews39 total 1-star reviews
2,262 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lynne M.September 13, 2022Verified Purchase
Vinyl Banner, 76cm x 183cm, Indoor
Zazzle Reviewer Program
Customization of the banner was very easy (even after multiple edits) and having a preview of the customization made me a lot more at ease about placing an order. I was afraid that the banner would arrived folded up in a small box and would have unsightly creases, however, that wasn't the case at all. The banner arrived in a sturdy cardboard triangular tube and was crease-free. I was pleasantly surprised with the overall quality of the materials. I was expecting it to be less but it appears to be very good quality (thick vinyl with properly installed metal grommets) and I would expect it to be long lasting. I would definitely recommend this product. The printing turned out beautifully; everything was lined up as I was expecting based on the preview. The ink had a uniform opaque appearance throughout (you couldn't see any white of the vinyl though it). Extremely professional looking.
5 out of 5 stars rating
By Louna H.October 8, 2022Verified Purchase
Vinyl Banner, 0.6m x 0.3m, Indoor
Zazzle Reviewer Program
I bought this product for my pop up market and like always zazzle never disappoints me it was excellent the colors and the materials were extremely well done I love dealing with zazzle. Everything was perfect the colors the size the materials it was exactly like the demo picture
5 out of 5 stars rating
By Stella K.September 21, 2021Verified Purchase
Vinyl Banner, 76cm x 244cm, Outdoor
Zazzle Reviewer Program
I have ordered from Zazzle a number of times and have never been disappointed with the quality of the product as well as the shipping speed and this order was no exception. I chose to customize a banner to take to fibre festivals where I sell my art. The instructions were very easy to follow and the choice of font was more than adequate. My logo was saved to the site from my first purchase and was easy to access to add to the banner. I had a choice of colours and was able to match the banner to the business cards and tags that I already purchased through Zazzle. The shipping was amazingly fast and Zazzle promises to "get it right". I've never had a problem and am more than happy with the whole process! It couldn't have been easier. The choice of background colour for the banner made it possible to match my already purchased business cards and tags. The lettering is crisp, clear, and easy to read. My logo has clean edges with no blurring and is easy to spot from a distance. The banner couldn't have turned out more perfectly! I'm thrilled with it.

Tags

Banners
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256325634972916561
Designed on 2017-11-20, 11:22 AM
Rating: G