Tap / click on image to see more RealViewsTM
Sale Price CA$3.74.  
Original Price CA$4.98 per card
You save 25%

Viking Pattern Blue

Qty:
Squared
+CA$0.35
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-CA$0.30
+CA$1.00

About Flat Cards

Sold by

Size: 8.9 cm x 12.7 cm

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 8.89 cm x 12.7 cm (portrait or landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2.3K Total Reviews
2016 total 5-star reviews162 total 4-star reviews34 total 3-star reviews22 total 2-star reviews69 total 1-star reviews
2,303 Reviews
Reviews for similar products
5 out of 5 stars rating
By Raylene W.December 9, 2024Verified Purchase
Flat Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Received my order and it was perfect! Would definitely buy again and recommend to anyone. Thanks so much!
5 out of 5 stars rating
By AnonymousJuly 29, 2025Verified Purchase
Flat Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared
I had ordered memorial cards for my mother’s funeral. I started to panic that I wouldn’t get them in time. The Zazzle team made it happen! They are amazing! They truly are a family company that demonstrates care & compassion to their customers. Plus, the cards are perfect!
5 out of 5 stars rating
By Ashley H.November 18, 2023Verified Purchase
Flat Card, Size: 20.3 cm x 10.2 cm, Paper: Basic Semi-Gloss, Corner: Squared
Zazzle Reviewer Program
These gift certificates are so perfect. I will definitely be ordering more!! Printing was perfect and the quality was very clear. Very happy with it!

Tags

Flat Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256091188921896013
Designed on 2017-11-17, 10:18 PM
Rating: G