Tap / click on image to see more RealViewsTM
CA$6.75
per card
 

Viking Pattern Blue

Qty:
Choose Your Format
Signature Matte
  • 17 pt thickness / 120 lb weight
  • Light white, uncoated matte finish with an eggshell texture
+CA$0.90
+CA$0.90
-CA$0.30

About Cards

Sold by

Size: Standard (12.7 cm x 17.8 cm)

Birthdays or holidays, good days or hard days, Zazzle’s customised greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 12.7 cm x 17.8 cm (portrait) or 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 7.62 cm x 10.16 cm (portrait) or 10.16 cm x 7.62 cm (landscape)
  • Blank white envelopes included

Paper Type: Matte

The most popular paper choice, Matte’s eggshell texture is soft to the touch with a smooth finish that provides the perfect backdrop for your chosen designs.

  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating7.4K Total Reviews
6777 total 5-star reviews486 total 4-star reviews71 total 3-star reviews27 total 2-star reviews33 total 1-star reviews
7,394 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kim B.January 21, 2019Verified Purchase
Zazzle Reviewer Program
You guys did an excellent job on my memorial cards of my beloved pet name Bailey. Thank you so so very much. It was absolutely perfect. Printing was absolutely stunning. Thank you for helping cherish this forever!!
5 out of 5 stars rating
By Ravi D.January 4, 2023Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Zazzle did a fantastic job with both creativity and delivery as product was received on time and many students kids and adults loved their cards. Highly recommended. Thanks Zazzle and look forward to the future cards and business. Clean, precise and accurate with details.
5 out of 5 stars rating
By penny m.December 26, 2023Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Grandkid was surprised that his name was in print. It brought a smile to his face. Quality was surpurb. was exactly as shown.

Tags

Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 137887351179637802
Designed on 2017-11-19, 10:04 AM
Rating: G