Tap / click on image to see more RealViewsTM
CA$37.85
per hat
 

veteran embroidered hat

Qty:
District Threads Distressed Chino Twill Cap
-CA$1.40
-CA$5.55
Light Olive

Other designs from this category

About Embroidered Hats

Sold by

Style: District Threads Distressed Chino Twill Cap

If you like the lived-in look, you'll love this enzyme-washed hat from District Threads. Comfortable as an old friend, it's 100% cotton and has an unstructured style with 6 panels and a low profile. Make it the perfect size with the metal D-ring slider buckle and hideaway cloth strap.

  • 100% cotton twill
  • Decoration style: digital embroidery
  • Low profile and unstructured
  • Metal D-ring slider buckle with hideaway strap closure
  • Due to a special finishing process, distress and color may vary
  • Care Instructions : Machine wash cold. Non-chlorine bleach, when needed. Tumble dry medium. Do not iron decorations/customization.

For some design guidance please see: How Do I Create a Design Suitable for Zazzle Embroidery

About This Design

veteran embroidered hat

veteran embroidered hat

veteran army

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
978 total 5-star reviews140 total 4-star reviews42 total 3-star reviews9 total 2-star reviews10 total 1-star reviews
1,179 Reviews
Reviews for similar products
5 out of 5 stars rating
By Innocent P.October 1, 2021Verified Purchase
Embroidered Hat, District Threads Distressed Chino Twill Cap
Zazzle Reviewer Program
It's super durable and the embroidery hasn't frayed or ripped at all! It's also adjustable in size! Super amazing. Hasn't come off or anything.
from zazzle.com (US)
5 out of 5 stars rating
By Stephen L.November 1, 2015Verified Purchase
Embroidered Hat, Alternative Apparel Basic Adjustable Cap
Zazzle Reviewer Program
Excellent quality hat. Love Yahuwah in Paleo Hebrew with white letters! Great stitch work, sturdy, durable hat. I really like the Scotland Blue color and the Distressed Chino is 100% Cotton! Looks great! The design and quality were excellent.
from zazzle.com (US)
5 out of 5 stars rating
By D.October 11, 2022Verified Purchase
Embroidered Hat, Alternative Apparel Basic Adjustable Cap
Zazzle Reviewer Program
This was exactly what we were looking for. It arrived looking like the picture, and is a good quality hat. No spare threads. Very good.

Tags

Embroidered Hats
veteranarmyusanavyiraqafghanistansyriawarsoldier
All Products
veteranarmyusanavyiraqafghanistansyriawarsoldier

Other Info

Product ID: 233248223040733076
Designed on 2019-04-09, 2:37 AM
Rating: G