Tap / click on image to see more RealViewsTM
CA$5.15
per sticker
 

UH60 Blackhawk Frontal Clear Decal, 4" x 2.5"

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 5 cm x 5 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 5 cm L x 2.12.7 cm W
  • Design Area: 5 cm L x 5 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

UH60 Blackhawk Frontal Clear Decal, 4" x 2.5"

UH60 Blackhawk Frontal Clear Decal, 4" x 2.5"

Clear Vinyl Decal with a frontal view of a Blackhawk Helicopter (H-60).

Customer Reviews

4.5 out of 5 stars rating25 Total Reviews
20 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews2 total 1-star reviews
25 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Chandler A.August 23, 2023Verified Purchase
10.16 cm x 10.16 cm Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The decal is perfect...it arrived ahead of schedule, was well priced and functions as a nice give away for our customers. It adheres well too. Chandler. Great job...the printing is very clear...
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By SAIR A.January 9, 2025Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
My first time trying Zazzle and Zazzle is amazing. The stickers are awesome and this is very good for business.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Dale B.March 14, 2025Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Glossy Transparent
Thing are great to label all the cases and property of my ministry/business equipment. It is very stylish and looks very good.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
uh 60uh60h60blackhawkstickerdecalflyarmyflyarmy
All Products
uh 60uh60h60blackhawkstickerdecalflyarmyflyarmy

Other Info

Product ID: 256386287272013575
Designed on 2021-11-18, 11:37 AM
Rating: G