Tap / click on image to see more RealViewsTM
CA$104.00
per pair of leggings
 

Tropical Parrot Birds All Over Print Leggings

Qty:

Other designs from this category

About Leggings

Sold by

Style: Leggings

Style and comfort make these the perfect pair of leggings. Custom-made with care; each pair is printed before being sewn, allowing for fun designs on every square inch. These leggings won't lose their shape so get comfy and look cool with your own unique pair.

Due to the cut-and-sew nature of each pair of leggings, designs, and prints may not match up at the seams. We do not recommend designs with words printed on or across the seam as they are hard to match precisely by even the most skilled of dressmakers.

Size & Fit

  • Full length leggings
  • Model is 5'10" and wearing a size S
  • Compression fit due to high spandex content; our leggings hug in all the right places and suit all body types

Fabric & Care

  • Material: Ultra-stretch polyester spandex blend. Legging is 79% polyester, 21% spandex. Capri is 88% polyester, 12% spandex
  • Sturdy, breathable, and stretches to fit your body
  • High spandex composition means compression fit won't lose shape; hugs in all the right places and bounces back after washing
  • Machine wash cold, gentle cycle. Or hand wash. Tumble dry medium heat. Do not bleach
  • Vibrant print won't fade after washing
  • Hand sewn in Canada

About This Design

Tropical Parrot Birds All Over Print Leggings

Tropical Parrot Birds All Over Print Leggings

Awesome collage of vintage botanical fine art of exotic tropical Parrot Birds and habitat Pods, etc., is on these great All Over Print Leggings. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating841 Total Reviews
719 total 5-star reviews87 total 4-star reviews17 total 3-star reviews9 total 2-star reviews9 total 1-star reviews
841 Reviews
Reviews for similar products
4 out of 5 stars rating
By Jan H.July 19, 2019Verified Purchase
All-Over-Print Leggings, XS (0-2)
Zazzle Reviewer Program
Love the leggings. Wore them to my pump class. Didn’t have to pull up once. Very comfortable. I’m 5’3 and weight about 118. I ordered a size small. Fit perfect except the ankles are a bit loose. I would suggest changing the background on these from white to a darker color as they are a bit see through. The waist is above my belly button. Very flattering. My design turned out beautiful.
5 out of 5 stars rating
By Linda S.January 2, 2022Verified Purchase
All-Over-Print Leggings, XS (0-2)
Zazzle Reviewer Program
it was fun selecting where to put the photos and words. i checked the preview several times so I did not end up with a picture or word going up her butt crack
4 out of 5 stars rating
By Kathryn P.February 20, 2023Verified Purchase
All-Over-Print Leggings, XS (0-2)
Zazzle Reviewer Program
I ordered 2 pairs of leggings and they are wonderful: thick, so you can wear them with just a long shirt. They are almost like wearing a comfortable girdle (that dates me). Colour fast and fit properly for my size. My only regret is that they are a little short in the waist. Legs are a little long, but I am only 5'4''. Printing is exact. No fading or running when washed in cold water.

Tags

Leggings
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds
All Products
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds

Other Info

Product ID: 256579313708620942
Designed on 2016-12-03, 6:47 PM
Rating: G