Tap / click on image to see more RealViewsTM
CA$28.30
per tile
 

The Griffin's Plume Tile

Qty:
15.24 cm x 15.24 cm
Frame and Keepsake Boxes available
Starting from CA$6.50
Select your accessory options after adding to cart

Other designs from this category

About Tiles

Sold by

Size: 15.24 cm x 15.24 cm

Display your favorite photos, images, and quotes on this vibrant ceramic tile. You can use your custom tile as a trivet or to upgrade your home décor. Great for holiday, wedding, and office gifts.

  • Dimensions: 6"l x 6"w; Thickness: 0.19"
  • Weight: 8.5 oz.
  • Made of white ceramic
  • Full-color, full-bleed printing
  • Intended for residential use. Suitable for dry or low-moisture indoor wall applications with brief exposure to water (such as backsplashes which are properly sealed and grouted). Not suitable for use on floors. Not suitable for constantly wet areas (like showers). Protect from exposure to direct sunlight. Not frost resistant.
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 6" x 6". For best results please add 1/8"" bleed

About This Design

The Griffin's Plume Tile

The Griffin's Plume Tile

Close-up shot of an ornate, decorative tile design. The design features a central, fan-like motif with alternating sections of light purple and light orange. This fan is framed by a green border that curves around the top and sides, with decorative swirls at the bottom corners. The border is further embellished with gold accents, particularly at the top and bottom.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
949 total 5-star reviews63 total 4-star reviews19 total 3-star reviews10 total 2-star reviews11 total 1-star reviews
1,052 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Scott M.August 14, 2024Verified Purchase
Ceramic Tile, 15.24 cm x 15.24 cm
A really beautiful item that I will keep for many years. I highly recommend! Strong beautiful image exactly as I hoped it would be.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Angela M.July 2, 2024Verified Purchase
Ceramic Tile, 15.24 cm x 15.24 cm
Beautiful Tile. Exactly what I was looking for. . Bright and beautiful. Colors are vibrant.
5.0 out of 5 stars rating
5 out of 5 stars rating
By B.January 14, 2020Verified Purchase
Ceramic Tile, 10.80 cm x 10.80 cm
Zazzle Reviewer Program
Was shipped quickly and packaging was superb... Product was simply beautiful, I would highly recommend! I wanted to keep the gift for myself😁. Printing looked great, it was flawless with a glossy finish... beautiful!!

Tags

Tiles
artdecoplumeshellpinkgreenwhitevintageceramictile
All Products
artdecoplumeshellpinkgreenwhitevintageceramictile

Other Info

Product ID: 256697075007500530
Designed on 2025-10-10, 10:49 PM
Rating: G