Tap / click on image to see more RealViewsTM
Sale Price CA$4.49.  
Original Price CA$5.98 per card
You save 25%

Thank You for Help Vintage Girl & Cat

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+CA$1.00
+CA$1.00
-CA$0.30
Vertical

Other designs from this category

About Folded Thank You Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Be obsessively grateful! Custom thank you cards for small things, big things, and everything in between.

  • Dimensions: 12.7 cm x 17.78 cm (portrait or landscape)
  • Full colour CMYK print process
  • Double-sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Thank You for Help Vintage Girl & Cat

Thank You for Help Vintage Girl & Cat

This sweet illustration of a girl feeding her cat is the perfect way to say thank you for your help. Image is from Graphics Fairy and is in the public domain. Public-Domain-Download-Girl-Cat-GraphicsFairy

Customer Reviews

4.8 out of 5 stars rating3.7K Total Reviews
3331 total 5-star reviews251 total 4-star reviews48 total 3-star reviews26 total 2-star reviews38 total 1-star reviews
3,694 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sandra P.July 17, 2020Verified Purchase
Folded Thank You Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte
Zazzle Reviewer Program
This was the first time I designed a card at Zazzle and ordered it to see how the quality of the print is...and I was really happy when I received the card today. My decision for a glossy finish paid off and all the colors are bright. The print is fantastic.
5 out of 5 stars rating
By Tristan F.December 21, 2024Verified Purchase
Folded Thank You Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Christmas cards are beautiful and better than expected. Great envelopes that fit the cards snuggly. Pictures are professional quality in print. Will definitely be using Zazzle again. .
5 out of 5 stars rating
By Vanessa V.November 25, 2024Verified Purchase
Folded Thank You Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte
Stunning cards I couldn't be happier with them. The quality of the paper is lovely & they turned out exactly like my design created on the website. Highly recommend will be re-ordering for sure !

Tags

Folded Thank You Cards
thankyouhelpvintagegirlcatfeedingmilksaucerbowl
All Products
thankyouhelpvintagegirlcatfeedingmilksaucerbowl

Other Info

Product ID: 137663167239947182
Designed on 2015-05-19, 5:48 AM
Rating: G