Tap / click on image to see more RealViewsTM
CA$18.65
per set of 10 labels
 

Tennis Wine Label

Qty:
Mini Wine Bottle Labels (5.1 cm x 7.6 cm)
-CA$7.50
-CA$7.50
-CA$9.35
-CA$11.25
-CA$7.50
-CA$7.50

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Mini Wine Bottle Labels (5.1 cm x 7.6 cm)

Easily customize mini wine bottles and make it 100% your own. Perfect for weddings, birthday parties, and baby showers.

  • Dimensions: (5.1 cm x 7.6 cm)
  • Each set includes 10 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time.
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive

About This Design

Tennis Wine Label

Tennis Wine Label

Tennis themed bottle labels with customisable text.

Customer Reviews

4.8 out of 5 stars rating159 Total Reviews
140 total 5-star reviews9 total 4-star reviews4 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
159 Reviews
Reviews for similar products
5 out of 5 stars rating
By Loredana G.June 28, 2023Verified Purchase
Water Bottle Label (21 cm x 5.4 cm)
Zazzle Reviewer Program
These turned out great for my daughter's bridal shower. I removed the paper label from the bottle and attached this sticker. Printing is beautiful.
5 out of 5 stars rating
By Rita D.November 10, 2022Verified Purchase
Food Container Label (5.1 cm x 7.6 cm)
Zazzle Reviewer Program
I bought these labels for my candle jars and they were perfect! Good quality. Able to peel them off without residue on the jar. Nice matte finish. Perfect! Exactly what was ordered
5 out of 5 stars rating
By Chelsea F.December 22, 2022Verified Purchase
Food Container Label (7.6 cm x 5.1 cm)
Zazzle Reviewer Program
Looked great, nice quality. Really nice, nice feel

Tags

Food and Beverage Label Sets
bottlelabelswinetennisplayerplayersracketracquetballsport
All Products
bottlelabelswinetennisplayerplayersracketracquetballsport

Other Info

Product ID: 256343308150577889
Designed on 2020-02-10, 5:56 AM
Rating: G