Tap / click on image to see more RealViewsTM
CA$45.20
each
 

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Qty:

Other designs from this category

About Towels

Sold by

Style: Bath Towel

Turn your bathroom into your own personal oasis with a custom towel perfect for drying you off in style. Towel set is a great gift for many occasions.

  • Dimensions: 76.2 cm x 152.4 cm
  • Material: front is a polyester blend, back is 100% cotton
  • Sublimation printing allows for vibrant printing designed to last
  • Machine washable, tumble dry on low

About This Design

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

My design features a beautiful tiled, pink flower motif, within a mosaic frame. This is a repeated, symmetrical pattern placed on a soft sage green, background. Adding a personalized name makes a charming gift idea. This item can be given a personalized name, with the design tool. Change the text and font to a style and color of your choice.

Customer Reviews

4.4 out of 5 stars rating540 Total Reviews
408 total 5-star reviews50 total 4-star reviews20 total 3-star reviews23 total 2-star reviews39 total 1-star reviews
540 Reviews
Reviews for similar products
5 out of 5 stars rating
By Miss R.January 14, 2024Verified Purchase
Hand Towel
Zazzle Reviewer Program
Soft, durable, great colour and great in the washer. Great colour and great line printing.
3 out of 5 stars rating
By Sue S.November 4, 2021Verified Purchase
Bathroom Towel Set
Zazzle Reviewer Program
It was advertised as NAVY blue and the color sent was greenish blue. I am disappointed in this product. Quality and printing are great as are all my other orders. As you can see in picture the tea towel on right is perfect, hand towel not so much! Print was awesome and just as ordered
4 out of 5 stars rating
By Debbie N.August 3, 2021Verified Purchase
Bathroom Towel Set
Zazzle Reviewer Program
Very happy that the product arrived on time. It's cute and the recipient loved it. My only concern is the quality of the towel , it's not bad - but not sure how well it will wash & hold up. The printing turned out good. Overall, I'm very happy & pleased with the product. Cheers! Happy with the print, the colours look good. Only concern is how well it will wash & hold up.

Tags

Towels
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic
All Products
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic

Other Info

Product ID: 256053667625050057
Designed on 2024-02-01, 3:29 AM
Rating: G