Tap / click on image to see more RealViewsTM
CA$27.00
per window cling
 

Sweet Tooth Monkey Window Cling

Qty:
30.5cm x 30.5cm
Opaque Design: All-over White Underbase
Rectangle

Other designs from this category

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 4” x 4” to a max of 52” x 72” (or max 72” x 52” if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Opaque Design: All-over White Underbase

Art is printed on a white sheet of plastic making colours look very dynamic. Please note that the white sheet is opaque and obscures text and art when viewed from the back of the window cling.

Adhesive: Cling art faces inward

Adhesive side is on the back of the window cling. All text and art is printed on the front of the window cling and faces towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window that it has been applied.

About This Design

Sweet Tooth Monkey Window Cling

Sweet Tooth Monkey Window Cling

This image shows an adorable baby monkey wearing a red straw hat with pink flowers. The monkey has large, expressive eyes and a sweet smile as it holds a red and white lollipop. It is dressed in a red dress with a white button. The monkey is sitting on a wooden surface.

Customer Reviews

3.6 out of 5 stars rating222 Total Reviews
127 total 5-star reviews13 total 4-star reviews6 total 3-star reviews16 total 2-star reviews60 total 1-star reviews
222 Reviews
Reviews for similar products
5 out of 5 stars rating
By Evgeny P.November 6, 2025Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Creator Review
Went out stylish. The cut lines are thin, and extra light definitely helps when cutting. Love the end result!
from zazzle.com (US)
1 out of 5 stars rating
By Amanda C.September 17, 2024Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
The design came out very nice but the product comes where the clear back clings to the surface where I wanted just the letters and design to cling to the surface NOT the actual clear backing with a square. If the designer sees this review can you contact me? I would like to re-order with the correct product I want. .
2 out of 5 stars rating
By Brianna L.June 13, 2025Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Custom Cut, Display: Back of Cling, Window Cling
Printing quality wasn't great, seemed a bit blurry.

Tags

Window Clings
monkeyapeanimalwildlifewildmammaljunglelollipopcutehat
All Products
monkeyapeanimalwildlifewildmammaljunglelollipopcutehat

Other Info

Product ID: 256709946835316456
Designed on 2024-10-19, 4:11 AM
Rating: G