Tap / click on image to see more RealViewsTM
CA$18.80
CA$2.35 per paper plate
 

Stylish Father’s Day Watch – Retro Badge Design wi Paper Plate

Qty:
17.78 cm Round Paper Plate
+CA$0.35
-CA$0.35
-CA$0.65

Other designs from this category

About Paper Plates

Sold by

Size and Style: 17.78 cm Round Paper Plate

Throw a spectacular party with fully customizable paper plates to match your theme! Each set of eight paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving cake, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 17.8 cm diameter
  • FDA compliant for food contact safety
  • Perfect for cake, appetizers, or salads
  • Printed in USA

About This Design

Stylish Father’s Day Watch – Retro Badge Design wi Paper Plate

Stylish Father’s Day Watch – Retro Badge Design wi Paper Plate

Give your dad the gift of style and sentiment with this retro-inspired Father’s Day watch. Designed with a bold circular badge, elegant stars, and a classic moustache motif, this timepiece is both fashionable and meaningful. A perfect accessory to show your appreciation and love — whether it's for Father’s Day or any day that celebrates him

Customer Reviews

4.5 out of 5 stars rating122 Total Reviews
97 total 5-star reviews7 total 4-star reviews8 total 3-star reviews4 total 2-star reviews6 total 1-star reviews
122 Reviews
Reviews for similar products
5 out of 5 stars rating
By G.May 2, 2024Verified Purchase
Paper Plates, 17.78 cm Square Paper Plate
This product is so pretty! The only thing they should do differently is to make the paper plates heavier and thicker. I love the printing and font!
5 out of 5 stars rating
By Linda G.April 23, 2022Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Zazzle Reviewer Program
I was honestly hoping the plate would be a little sturdier for the price. As far as the image goes, it is just lovely. I had a hard time deciding between square and round, but went with the square because the design fit better. If the round plate’s design would have a more rounded edge at the sides of the plate, I would have taken that one…only because it is so much easier to find round charger plates or mats to go underneath. My opinion only! Not sorry I bought these at all, as they will definitely cause a positive response from the guests, I’m sure. design was excellent and printing was perfect I ordered them early in February for an August special anniversary party. Very glad I did, because I noticed the plates were sold out within a month.
5 out of 5 stars rating
By Marlene R.June 11, 2022Verified Purchase
Paper Plates, 17.78 cm Round Paper Plate
Zazzle Reviewer Program
Beautiful design - sturdy plates. Would definitely order from Zazzle again. Shipping was quite fast as well. The detail and colors were exactly as I had hoped. Beautiful plates.

Tags

Paper Plates
fathergiftstylishdadwatchtimepiecemoustachebadge
All Products
fathergiftstylishdadwatchtimepiecemoustachebadge

Other Info

Product ID: 256149138393324037
Designed on 2025-06-01, 4:04 AM
Rating: G