Tap / click on image to see more RealViewsTM
Sale Price CA$3.42.  
Original Price CA$4.55 per card
You save 25%

Simple Black and White Script Save The Date

Qty:
Choose Your Format
Squared
+CA$0.35
+CA$0.40
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+CA$0.90

Other designs from this category

About Flat Save The Date Cards

Sold by

Size: 12.7 cm x 17.8 cm

Hip hip hooray, it's time to spread the good cheer; a date so important you have to save it!

  • Dimensions: 12.7 cm L x 17.8 cm H (portrait); 17.8 cm L x 12.7 cm H (landscape)
  • High-quality, full-colour, full-bleed printing on both sides
  • Add personal photos and text for no additional upcharge
  • Envelopes included but can be removed if not needed

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Simple Black and White Script Save The Date

Simple Black and White Script Save The Date

This simple black and white save the date card features a pretty script save the date with a leaf motif, set above your details in an elegant modern text.

Customer Reviews

4.8 out of 5 stars rating2.5K Total Reviews
2169 total 5-star reviews211 total 4-star reviews43 total 3-star reviews21 total 2-star reviews27 total 1-star reviews
2,471 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.August 29, 2023Verified Purchase
Flat Save The Date Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
I love these save the dates! They’re printed on thicker paper so they’re very durable. They came earlier than expected and are so beautiful. I love how easy they were to customize! We got many compliments on them. The pictures were vibrant and clear. The save the dates came exactly as I designed them. In the photos, I blocked out the information for privacy purposes. Absolutely beautiful. 100% recommend!
5 out of 5 stars rating
By M.April 1, 2024Verified Purchase
Flat Save The Date Card, Size: 12.7 cm x 17.8 cm, Paper: Premium Soft Touch, Corner: Squared
Great way to inform family of upcoming wedding. Easy to load picture and personalize. Great quality! Very durable material and good size.
5 out of 5 stars rating
By C.January 31, 2022Verified Purchase
Flat Save The Date Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
I loved being able to edit my Save the Dates the way I wanted to before purchasing them. They turned out exactly as I pictured and couldn’t be happier. Thank you Zazzle! Perfect, exactly as I requested

Tags

Flat Save The Date Cards
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif

Other Info

Product ID: 256766060584492636
Designed on 2019-12-05, 8:50 AM
Rating: G