Tap / click on image to see more RealViewsTM
The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
CA$25.40
per pack of 50
 

Silver Frame / Cursive Typography Mini Business Card

Qty:
Standard Semi-Gloss

16 pt thickness / 400 GSM weight
Bright white, semi-gloss finish

+CA$12.85
+CA$12.85
+CA$12.85
+CA$25.55
+CA$25.55
+CA$25.55

Other designs from this category

About Business Cards

Sold by

Size: Mini, 76 mm x 25 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 76 mm x 25 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Standard Semi-Gloss

Our most versatile and economical paper, Standard Semi-Gloss produces crisp, vibrant images with exceptional colour and detail—a solid choice for all your printing needs.

  • 16 pt thickness / 400 GSM weight
  • Bright white, semi-gloss finish
  • 50% recycled content
  • Paper imported from Italy

About This Design

The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Silver Frame / Cursive Typography Mini Business Card

Silver Frame / Cursive Typography Mini Business Card

Add your text and company information on these template ready business cards. Recommended best on a heavy stock paper for higher print quality and more protective substrate. For any design requests contact the designer. ©2010 Joshua Martin

Customer Reviews

4.7 out of 5 stars rating40.2K Total Reviews
33429 total 5-star reviews3931 total 4-star reviews1060 total 3-star reviews690 total 2-star reviews1093 total 1-star reviews
40,203 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lori B.May 18, 2022Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
The cards turned out lovely! Just enough colour and design to look good and be easy to read . Sturdy card stock as well. The soft pink watercolour looks really pretty on it! Printing is very nice. It’s clear and well designed
5 out of 5 stars rating
By Marie S.July 2, 2022Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Signature Matte, Corners: Rounded
Zazzle Reviewer Program
I am so happy with these custom earring card backs. The process of designing then was easy and straightforward. There was an error with my initial order due and they refunded me and printed again right away. My cards are sleek, professional and perfect for my small business. They arrive promptly. I am very pleased to also be supporting other independent creatives like myself.. The print quality was exceptional!
5 out of 5 stars rating
By Carmen R.December 10, 2023Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I'm super happy with my cards I always get compliments on them. No complaints they are perfect!!

Tags

Business Cards
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance
All Products
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance

Other Info

Product ID: 240010312512147661
Designed on 2017-12-16, 11:55 PM
Rating: G