Tap / click on image to see more RealViewsTM
CA$9.85
per sticker
 

Sedna (2003 VB12)

4.5 out of 5 stars rating
1146 Total Reviews |
by
Qty:
Sticker Sheet Size
Paper Type

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl StickerCreate your own from scratch

Sticker Sheet Size: 10.16 cm x 10.16 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 10.2 cm L x 4.12.7 cm W
  • Design Area: 10.2 cm L x 10.2 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Sedna (2003 VB12)

Sedna (2003 VB12)

Sedna is an unofficial dwarf planet that orbits in the outer regions of the solar system. While it takes over 12,000 years to complete its orbit, it will be at it's closest aproach in 2071. Sedna's unusual orbit may be evidence for another planet in our solar system, known as planet 9 or planet X. Sedna is the Inuit goddess of sea creatures. Image created in procreate.
OrchardSCIENCE
Silver
Artwork designed by
Vancouver, BC
View their Store

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
920 total 5-star reviews74 total 4-star reviews28 total 3-star reviews32 total 2-star reviews92 total 1-star reviews
1,146 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Megan O.January 22, 2024 • Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
4.0 out of 5 stars rating
4 out of 5 stars rating
By Katie L.October 18, 2022 • Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Glossy clear
Zazzle Reviewer Program
I love the clear background so that all you see is the writing, looks very elegant. Little on the pricey side, but worth it. They stick great to my plastic containers, hopefully it withstands in the shower. Printing was flawless
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kristin R.January 2, 2020 • Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great

Tags

Custom-Cut Vinyl Stickers
spaceastronomysolar systemsednaredplanetdwarfplanet 9inuitdata
All Products
spaceastronomysolar systemsednaredplanetdwarfplanet 9inuitdata

Other Info

Product ID: 256437812644068238
Designed on 2023-08-19, 11:31 AM
Rating: G