Sell on Zazzle
Tap / click on image to see more RealViewsTM
CA$3.55
per sticker
 

Sally's Magical Halloween Adventure

4.6 out of 5 stars rating
1059 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm L x 8.89 cm H
  • Design Area: 7.62 cm L x 7.62 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317. cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Sally's Magical Halloween Adventure

Sally's Magical Halloween Adventure

This charming illustration reimagines Sally from "The Nightmare Before Christmas" in a festive Halloween setting. Sally, with her vibrant red hair and patchwork dress, is joyfully participating in the Halloween festivities. She is surrounded by friendly ghosts and whimsical trees under a crescent moon, capturing a scene of magical enchantment. The atmosphere is lively and playful, filled with stars, a jack-o'-lantern, and a hint of autumn magic.
Disney's The Nightmare Before Christmas
Artwork designed by
View their Store
Contact

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
884 total 5-star reviews70 total 4-star reviews25 total 3-star reviews20 total 2-star reviews60 total 1-star reviews
1,059 Reviews
Reviews for similar products
4 out of 5 stars rating
By Katie L.October 18, 2022 • Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
I love the clear background so that all you see is the writing, looks very elegant. Little on the pricey side, but worth it. They stick great to my plastic containers, hopefully it withstands in the shower. Printing was flawless
5 out of 5 stars rating
By Megan O.January 22, 2024 • Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5 out of 5 stars rating
By Kristin R.January 2, 2020 • Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great

Tags

Custom-Cut Vinyl Stickers
nightmare before christmasnightmare before christmas sallyhalloweenghostsjack o lanternpumpkinsgraveyardcemetarycrescent moonmoonlight
All Products
nightmare before christmasnightmare before christmas sallyhalloweenghostsjack o lanternpumpkinsgraveyardcemetarycrescent moonmoonlight

Other Info

Product ID: 256956450363631270
Designed on 2024-10-01, 2:54 PM
Rating: G