Tap / click on image to see more RealViewsTM
CA$10.90
per sticker
 

Saigon (Ho Chi Minh City) HCMC Vietnam Holiday

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Medium 15.24 cm x15.24 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm L x 16.51 cm H
  • Design Area: 15.24 cm L x 15.24 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Saigon (Ho Chi Minh City) HCMC Vietnam Holiday

Saigon (Ho Chi Minh City) HCMC Vietnam Holiday

Saigon (Ho Chi Minh City) HCMC Vietnam panorama souvenir for holiday. Saigon city urban cityscape design with skyline for Vietnam travel. Lifestyle for urban backpackers and Saigon or Ho Chi Minh City travel. Saigon (Ho Chi Minh City) HCMC Vietnam skyline at night. Saigon or Ho Chi Minh City panorama for vacation in Vietnam. Saigon city souvenir for Vietnam and HCMC trip. You can easily customize and personalize the design by enter the name you want.

Customer Reviews

4.6 out of 5 stars rating24 Total Reviews
20 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
24 Reviews
Reviews for similar products
5 out of 5 stars rating
By Chandler A.August 23, 2023Verified Purchase
Small 10.16 cm x10.16 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The decal is perfect...it arrived ahead of schedule, was well priced and functions as a nice give away for our customers. It adheres well too. Chandler. Great job...the printing is very clear...
from zazzle.com (US)
5 out of 5 stars rating
By SAIR A.January 9, 2025Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
My first time trying Zazzle and Zazzle is amazing. The stickers are awesome and this is very good for business.
from zazzle.com (US)
5 out of 5 stars rating
By Dale B.March 14, 2025Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Thing are great to label all the cases and property of my ministry/business equipment. It is very stylish and looks very good.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
saigonho chi minh cityhcmcvietnamnightnighttimeskylinepanoramacityscaperetro
All Products
saigonho chi minh cityhcmcvietnamnightnighttimeskylinepanoramacityscaperetro

Other Info

Product ID: 256911497533636632
Designed on 2023-04-22, 10:33 AM
Rating: G