Tap / click on image to see more RealViewsTM
CA$47.35
per shirt
 

Riding the Wave to Success T-shirt

Qty:
Basic Dark T-Shirt
+CA$14.90
+CA$44.50
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customize it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Riding the Wave to Success T-shirt

Riding the Wave to Success T-shirt

This t-shirt design features a line graph that climbs steadily up a mountain peak, reaching the summit. The design is perfect for new trading graphics designers who are looking to show off their skills and determination. The mountain motif represents the challenges and rewards of trading, while the line graph symbolizes success.

Customer Reviews

4.7 out of 5 stars rating32.4K Total Reviews
25347 total 5-star reviews4962 total 4-star reviews1098 total 3-star reviews492 total 2-star reviews456 total 1-star reviews
32,355 Reviews
Reviews for similar products
5 out of 5 stars rating
By Bob L.July 1, 2022Verified Purchase
Basic Dark T-Shirt, Black, Adult L
Zazzle Reviewer Program
They turned out exactly as we had hoped and we looked good even when we didn't bowl well. The printing was perfect and you can only see 9 pins on the shirt(the 5 pin hidden behind the headpin) which worked for us as we bowled in a 9 pin No-Tap league.
5 out of 5 stars rating
By AnonymousJune 23, 2025Verified Purchase
Basic Dark T-Shirt, Navy Blue, Adult S
The shirt I ordered was too small. I contacted Zazzle and they replaced it with a larger size. Very happy. .
5 out of 5 stars rating
By Toni D.November 6, 2022Verified Purchase
Basic Dark T-Shirt, Black, Adult S
Zazzle Reviewer Program
Great t-shirt!!! Quality is amazing and the colours are vibrant. Exactly how described!!! Can’t wait for my daughter to ask and give it to her confirmation sponsor. It’s also came earlier than I expected. Colours were exactly what I expected. The quality is amazing. The images couldn’t be any better. I’m very happy with his product and highly recommend it.

Tags

T-Shirts
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger
All Products
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger

Other Info

Product ID: 256145644063570158
Designed on 2024-03-29, 11:27 PM
Rating: G