Tap / click on image to see more RealViewsTM
The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Sale Price CA$3.15.  
Original Price CA$4.19 per card
You save 25%

Retirement Party Elegant Pink Rose Gold Feminine Invitation

Qty:
Choose Your Format
Squared
+CA$0.35
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-CA$0.24
+CA$0.91

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from multiple unique paper types, printing options, and shapes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Retirement Party Elegant Pink Rose Gold Feminine   Invitation

Retirement Party Elegant Pink Rose Gold Feminine Invitation

This elegant pink and rose gold retirement party invitation with a vintage air, recommended for a woman, has an ornate (faux) rose gold foil frame with elegant baroque decorations on a blush pink background. The name is written in an elegant calligraphy. All text can be personalized and has a pink colour similar to the rose gold frame. The vintage, ornate frame is based on an antique French book cover binding, by Georges Mercier (1885-1939) - Madame de Maupin by Teophile Gautier, edition 1911, now in the public domain.

Customer Reviews

4.8 out of 5 stars rating69.7K Total Reviews
61712 total 5-star reviews5714 total 4-star reviews1010 total 3-star reviews480 total 2-star reviews751 total 1-star reviews
69,667 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kim B.February 18, 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I was very impressed with the quality of the invitations especially when I like to look and touch any product I buy. They are very elegant and good quality. They arrive exactly like promised and packaged well as there was no damage. Great Job!! Very satisfied with the quality. Job well done!
5 out of 5 stars rating
By M.December 22, 2020Verified Purchase
Zazzle Reviewer Program
These personalized Christmas cards were so pretty and the added touch of making it personal was just so perfect! The printing was clear and legible, no bleeding of the ink!
Original product
5 out of 5 stars rating
By N.August 12, 2020Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I am so happy with Zazzle and the designs available for customisation are so unique and classy. Customer service also is great. Highly recommended! The printing as expected. Excellent quality!

Tags

All Products
retirement partyelegantblush pinkrose goldfemininevintagecalligraphyscriptornateantique

Other Info

Product ID: 256290993018250813
Designed on 2025-08-10, 12:56 PM
Rating: G